DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rabex-5 and vps9d1

DIOPT Version :9

Sequence 1:NP_612093.1 Gene:Rabex-5 / 38144 FlyBaseID:FBgn0262937 Length:696 Species:Drosophila melanogaster
Sequence 2:XP_005169985.1 Gene:vps9d1 / 503773 ZFINID:ZDB-GENE-050306-57 Length:685 Species:Danio rerio


Alignment Length:347 Identity:80/347 - (23%)
Similarity:132/347 - (38%) Gaps:87/347 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 QKKKFTAVLQKTLQAGAQKITQQRGHVPDPTEGQFLLQLRQLRIPDDGKRKLKLEIQRLDSDIRK 165
            |:..|.:.|..:|...:..::..|....:.|:.:        ..|||....|..:.:....|:.|
Zfish   366 QQSPFKSALTHSLSDASISLSPSRDLNANDTKSE--------ADPDDSSSLLTTDRENSFEDLEK 422

  Fly   166 YMN------GNGG------------KNINELSDLVQNAYTK--VSDIVHND---------PSFE- 200
            ::.      .:.|            ..|::|.:.....:.|  |.|| ||.         .||| 
Zfish   423 FLTQLDWVPSHSGDDDDTDPDVTFESQIHDLEERALKEHLKAIVKDI-HNAIDRLLSLCLLSFEC 486

  Fly   201 IATNEDRDSAIDFFEKVVMTQNHKFLFSPYFTTDEDSDVKVQKRIRQLSWITAKHL--DCSIDEV 263
            :.|...:|..:...|:|..|...:.|.:.:.....:.:..|:         ::.||  ..|..:|
Zfish   487 LNTANSKDQCVASMEEVFFTPIWRPLLALFRKVHGEREQAVE---------SSMHLYHHVSPGDV 542

  Fly   264 NSEA----RDLVY--------NAISELVGIDSYYSPQEKLQCTWR-----C-CRHIFELLKRATG 310
            ...:    |||..        :|:.||..:...|.||:||:|..|     | |...:.||:....
Zfish   543 GVASKLFPRDLAVLHGSYPYESAVQELKLLCREYCPQKKLECIVRTLRIICGCAEDYRLLQENDP 607

  Fly   311 GPAS----ADDFLPALIFVVLKANPVRLHSNINFVTRFTNASRLMSGESGYYFTNLCSAIAFIEN 371
            .|.|    |||.||.|.||.|::...:|.|....:..|.:...|: ||.||..|:|.||:.::|:
Zfish   608 PPRSAAIGADDLLPILAFVALRSEMPQLVSECAALEEFIHEGYLI-GEEGYCLTSLQSALTYVES 671

  Fly   372 LNGESLGVSSEEFEALMSGQQP 393
            :              |.||..|
Zfish   672 M--------------LPSGAPP 679

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rabex-5NP_612093.1 zf-A20 17..40 CDD:280010
VPS9 274..373 CDD:280383 38/108 (35%)
vps9d1XP_005169985.1 VPS9 562..674 CDD:280383 38/126 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170584033
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2319
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.