DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rabex-5 and ankrd27

DIOPT Version :9

Sequence 1:NP_612093.1 Gene:Rabex-5 / 38144 FlyBaseID:FBgn0262937 Length:696 Species:Drosophila melanogaster
Sequence 2:XP_021326420.1 Gene:ankrd27 / 386887 ZFINID:ZDB-GENE-121105-1 Length:1063 Species:Danio rerio


Alignment Length:318 Identity:65/318 - (20%)
Similarity:124/318 - (38%) Gaps:44/318 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 QQRGHVPDPTEGQFLLQLRQLRIPDDGKRKLKLEIQRLDSDIRKY---MNGNGGKNINELSDLVQ 183
            ::.|.||.|         ..|:..:|.:..|....::||..:..:   ......|.:....|.|.
Zfish   162 EELGSVPAP---------YCLKNIEDVREFLGRHAEKLDKFVSSFCLSFKEQERKGLRHHIDSVN 217

  Fly   184 NAYTKVSDIVHNDPSFEIATNEDRDSAI--DFFEKVVMTQNHKFLFSPYFTTDEDSDVKVQKRIR 246
            ..||:....:..|...::...::....:  :..|..:....|..|||...|.:...|....|..|
Zfish   218 TLYTRCLQCLLRDSRLKLLARQEIQMTLLKEAVEMYIHHGIHDLLFSYVGTLEASRDAAFNKTTR 282

  Fly   247 QLSWITAKHLDCSIDEVNSEARDLVYNAISELVGIDSYYSPQEKLQCTWRCCRHIFELLKRATGG 311
            .|..:..|.|.     |.||....:..|..||:.::...|||:||.|..:....|.:..:|....
Zfish   283 SLQDLQQKELG-----VKSEFSINIPRAKRELIQLNVCTSPQQKLLCIRKVILTIMQSTRRRDTA 342

  Fly   312 PA----SADDFLPALIFVVLKANPVRLHSNINFVT--RFTNASRLMSGESGYYFTNLCSAIAFI- 369
            .:    .|||.|..::::::|.......:|::::.  ||.::|:   .|..|..|:..:|:.:| 
Zfish   343 VSIESMCADDLLLVILYLLIKTEIPNWMANLSYIKHFRFRSSSK---DELSYCLTSFEAAVEYIS 404

  Fly   370 -----ENLNGESLGVS-SEEFEALMSGQQPYSTPWESALLACESLHLISENMKRMEML 421
                 .|.:|....:| .::.:.|.....|....:|         |::|.|.:.::.|
Zfish   405 LGNLKHNTDGSGNRLSFRQKVDLLSQNATPIDRLFE---------HIVSGNEQEVQRL 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rabex-5NP_612093.1 zf-A20 17..40 CDD:280010
VPS9 274..373 CDD:280383 26/110 (24%)
ankrd27XP_021326420.1 VPS9 302..403 CDD:327588 24/103 (23%)
ANK 494..621 CDD:238125
ANK repeat 498..529 CDD:293786
ANK repeat 531..562 CDD:293786
ANK repeat 564..598 CDD:293786
ANK repeat 600..631 CDD:293786
Ank_2 <603..>932 CDD:330894
ANK repeat 709..736 CDD:293786
ANK 773..898 CDD:238125
ANK repeat 778..809 CDD:293786
ANK repeat 811..842 CDD:293786
ANK repeat 844..875 CDD:293786
ANK repeat 877..908 CDD:293786
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2319
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.