DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rabex-5 and Gapvd1

DIOPT Version :9

Sequence 1:NP_612093.1 Gene:Rabex-5 / 38144 FlyBaseID:FBgn0262937 Length:696 Species:Drosophila melanogaster
Sequence 2:NP_572704.1 Gene:Gapvd1 / 32070 FlyBaseID:FBgn0030286 Length:1712 Species:Drosophila melanogaster


Alignment Length:451 Identity:109/451 - (24%)
Similarity:183/451 - (40%) Gaps:110/451 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 QQDLKCRS-----GCGFYGT---PQNEGLCSMCFREKFNDKQRKLK--QTGGETGPGSSSSVATL 68
            |.|::..|     ||..:||   ..:|.:.:. :|.|.:.......  .||...|.||:.||.. 
  Fly  1278 QADIRSVSFDPSAGCDNFGTHYCDTSEDILAK-YRRKVSSSSEATNSDSTGNGHGVGSTGSVGA- 1340

  Fly    69 DRRSPQHAHLQGK---------VEQQVRKPSDKEQDNLGTLQKKKFTAV-----LQKTLQAG-AQ 118
              .:..|.|:.|.         |:|::|....:...:.|..::...|:.     ||..||.. ||
  Fly  1341 --AAHLHKHMNGGHIPGVVFGCVKQKLRTVLSRTDLHSGDFRQTSTTSTTMATPLQIYLQIQLAQ 1403

  Fly   119 KITQQR----GHVPD----------PTEGQFLLQL------------------RQLRIPDDGKRK 151
            .|:.||    .||.:          |..||.|.:|                  :||.:..:...:
  Fly  1404 CISLQRLPQISHVAEALRCLAQLERPQHGQLLAELQRDLERRQSYLQYLMRHRQQLLLRSEQLEQ 1468

  Fly   152 LKLEI-------QR--LDSDIRKYMNGNGGKNINELSDL-VQNAYTKVSD--IVHNDPSFEIATN 204
            |:..:       ||  |.:.:|.|:..:  :...:|... .:.|..:.||  :...:...|....
  Fly  1469 LEARLRGEARSSQRCLLQALVRMYLAWS--RQQEKLEQFQAEFAQLRASDERVELTEEFVESLLQ 1531

  Fly   205 EDRDSA-------ID----FFEKVVMTQNHKFLFSPYFTTDEDSDV-----------KVQKRIRQ 247
            |.|.||       :|    ..|::::.|.::.:..|    :||:||           |:|:.:. 
  Fly  1532 ELRSSADLQDEWQVDAARVAIERMLLEQMYEQVMFP----NEDADVSRDEVLSAHIGKLQRFVH- 1591

  Fly   248 LSWITAKHLDCSIDEVNSEARDLVYNAISELVGIDSYYSPQEKLQCTWRCCRHIFELLKRATGGP 312
                .|....|...|...||....  |..:|..:.:|.:|:|||||...|...|..||:.::|..
  Fly  1592 ----PAHPALCIAQEYLGEAPWTF--AQQQLCHMAAYKTPREKLQCIINCISSIMSLLRMSSGRV 1650

  Fly   313 ASADDFLPALIFVVLKANPVRLHSNINFVTRFTNASRLMSGESGYYFTNLCSAIAFIENLN 373
            .:|||.||.||:||:.|||..|.|.:.:::.|  ..:.:.||..:|:|...|.:.||:.::
  Fly  1651 PAADDLLPVLIYVVIMANPPYLLSTVEYISCF--LGKKLEGEDEFYWTLFGSVVKFIKTMD 1709

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rabex-5NP_612093.1 zf-A20 17..40 CDD:280010 6/30 (20%)
VPS9 274..373 CDD:280383 36/98 (37%)
Gapvd1NP_572704.1 RasGAP_RAP6 90..460 CDD:213331
VPS9 1609..1709 CDD:280383 36/103 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454064
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2319
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D944088at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23101
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.