DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rabex-5 and Rinl

DIOPT Version :9

Sequence 1:NP_612093.1 Gene:Rabex-5 / 38144 FlyBaseID:FBgn0262937 Length:696 Species:Drosophila melanogaster
Sequence 2:XP_006540161.3 Gene:Rinl / 320435 MGIID:2444024 Length:567 Species:Mus musculus


Alignment Length:399 Identity:75/399 - (18%)
Similarity:138/399 - (34%) Gaps:117/399 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 TGGET-GPGSSSSVATLDRRSPQHAHLQGKVEQQVRKPSDKEQDNLGTLQKKKFTAVLQKTLQAG 116
            ||.|. .||:.:.    ...|..|.......|::|.....|::|..|.  :...||.::...:..
Mouse   228 TGQEVHHPGADAH----SLGSEVHFSCPALEEEEVNNDCYKDEDEEGC--EDMLTAHIRALARTR 286

  Fly   117 AQKITQQRGHVPDPTEGQFLLQLRQLRI-----------PDDGKRKLKLEIQRLDSDIRKYMN-- 168
            :..:.:               |.|.||.           |.|...:|..::::|.:|::.|:.  
Mouse   287 SSYVAR---------------QYRCLRARLISDSGNPYSPGDPATELLQDVRQLLTDLQNYLAKD 336

  Fly   169 -------GNGGKNINELSDLVQNAYTKVSDIVHNDPSFEIATNEDRDSAIDFFEKVVMTQNHKFL 226
                   ||.|.:|....||              .|:.|:|           ..:.|:......|
Mouse   337 PDVRAVFGNRGPSILREEDL--------------GPAVEVA-----------LCRAVLEPLKPAL 376

  Fly   227 FSPYFTTDEDSDVKVQKRIRQLSWITAKHLDCSI---DEVNSEA---RDLVYNAISELVGIDSYY 285
            ::...|.          |.::|..:..:.:...:   .|..|.|   |:.::   :.|..:.:..
Mouse   377 WTKLRTL----------RAQELRRLRRRQIALRVGAGPEGQSPALRNRNRIH---ARLAHLHAAC 428

  Fly   286 SPQEKLQCTWRCCRHIFELLKRATGG-----PASADDFLPALIFVVLKANPV-RLHSNINFVTRF 344
            :|:.|:......|..::..|    ||     |..||.|||||...::.:..: ....::.|:...
Mouse   429 APRRKVALLLAVCSDVYAGL----GGGENKEPLGADAFLPALTEELIWSPHIGETQLDVEFLMEL 489

  Fly   345 TNASRLMSGESGYYFTNLCSAIAFIENLNGES----LGVSSE----------------EFEALMS 389
            .:...| .||:|||.|....|:..|.:...::    .|:|||                :.:....
Mouse   490 LDPGEL-RGEAGYYLTTWFGALYHIAHYQPDTGRAPQGLSSEARASLRQWHRRRTLHQQAQPTAQ 553

  Fly   390 GQQPYSTPW 398
            ..||:..||
Mouse   554 ANQPFEEPW 562

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rabex-5NP_612093.1 zf-A20 17..40 CDD:280010
VPS9 274..373 CDD:280383 25/104 (24%)
RinlXP_006540161.3 SH2 96..189 CDD:387587
VPS9 416..518 CDD:366977 25/109 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167839933
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.