DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rabex-5 and Gapvd1

DIOPT Version :9

Sequence 1:NP_612093.1 Gene:Rabex-5 / 38144 FlyBaseID:FBgn0262937 Length:696 Species:Drosophila melanogaster
Sequence 2:XP_006234089.1 Gene:Gapvd1 / 311880 RGDID:1307479 Length:1484 Species:Rattus norvegicus


Alignment Length:429 Identity:102/429 - (23%)
Similarity:169/429 - (39%) Gaps:115/429 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 STAARPPSLRLGQQDLK-------C--------------RSGCGFYGTPQ-NEGLCSM------- 37
            |.||.|....|..:|:|       |              |:|...:..|: ||.:|.:       
  Rat  1111 SQAAHPQDSALSYRDVKKKLRLALCSADSVAFPMLTHSTRNGLPEHTDPEDNEIVCFLKVQIAEA 1175

  Fly    38 -----------------CFREKFNDKQRKLKQTGGETGPGSSSSVATLDR----RSPQHAHLQGK 81
                             |.....|...|||..:..|.....:..:|.|.|    .....|||:..
  Rat  1176 INLQDKSLMAQLQETMRCVCRFDNRTCRKLLASIAEDYRKRAPYIAYLTRCRQGLQTTQAHLERL 1240

  Fly    82 VEQQVRKPSDKEQDNLGTLQKKKFTAVLQKTLQAGAQKITQQRGHVPDPTEGQFLLQLRQLRIPD 146
            :::.:|   |||..|      :.||.|..:.|....:|..:           :|:...::|...|
  Rat  1241 LQRVLR---DKEVAN------RYFTTVCVRLLLESKEKKIR-----------EFIQDFQKLTAAD 1285

  Fly   147 DGKRKLKLEIQRLDSDIRKYMNGNGGKNINELSDLVQNAYTKVSDIVHNDPSFEIATNEDRDSAI 211
            |                          ...::.|.:|..|..::    .|..::.|:.|....|.
  Rat  1286 D--------------------------KTAQVEDFLQFLYGAMA----QDVIWQNASEEQLQDAQ 1320

  Fly   212 DFFEKVVMTQNHKFLFSPYFTTDEDSDV----KVQKRIRQLS-WITAKHLDCSIDEVNSEARDLV 271
            ...|:.||.:..|..|.|    ::|.|:    .:.:.|::|| .:||.|....|.||  ..|:..
  Rat  1321 LAIERSVMNRIFKLAFYP----NQDGDILRDQVLHEHIQRLSKVVTANHRALQIPEV--YLREAP 1379

  Fly   272 Y-NAISELVGIDSYYSPQEKLQCTWRCCRHIFELLKRAT-GGPASADDFLPALIFVVLKANPVRL 334
            : :|.||:..|.:|.:|::|:||..|.|..|..||..|. .....||||:|.|:||::||||..|
  Rat  1380 WPSAQSEIRTISAYKTPRDKVQCILRMCSTIMNLLSLANEDSVPGADDFVPVLVFVLIKANPPCL 1444

  Fly   335 HSNINFVTRFTNASRLMSGESGYYFTNLCSAIAFIENLN 373
            .|.:.:::.|  .:..:|||..|::....:|:.||:.::
  Rat  1445 LSTVQYISSF--YASCLSGEESYWWMQFTAAVEFIKTID 1481

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rabex-5NP_612093.1 zf-A20 17..40 CDD:280010 9/68 (13%)
VPS9 274..373 CDD:280383 37/99 (37%)
Gapvd1XP_006234089.1 RasGAP_RAP6 84..449 CDD:213331
VPS9 1380..1481 CDD:280383 37/102 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2319
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D944088at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.