DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rabex-5 and Vps9d1

DIOPT Version :9

Sequence 1:NP_612093.1 Gene:Rabex-5 / 38144 FlyBaseID:FBgn0262937 Length:696 Species:Drosophila melanogaster
Sequence 2:XP_006255829.1 Gene:Vps9d1 / 307923 RGDID:1565149 Length:648 Species:Rattus norvegicus


Alignment Length:348 Identity:85/348 - (24%)
Similarity:131/348 - (37%) Gaps:94/348 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 GPGSSSSV-----ATLDRRSPQHAHLQGKVEQQVRKPSDKEQDNLGTLQKKKFTAVLQKTLQAGA 117
            ||.|:.|:     .||||.:.             ..|:......:|.|.                
  Rat   357 GPPSTPSIPILHSGTLDREAD-------------GSPAGPSSPLVGALP---------------- 392

  Fly   118 QKITQQRGHVPDPTEG-----QFLLQLRQLRIPDDGKRKLKLEIQRLDSDIRKYMNGNGGKNINE 177
                    |:||....     || |.:.:.:.| ..||:..||.  |.|.::...|.     |:.
  Rat   393 --------HLPDKDSSFEDLEQF-LAMSEPQTP-GAKREPLLEC--LKSTVKDIHNA-----IDR 440

  Fly   178 LSDLVQNAYTKVSDIVHNDPSFEIATNEDRDSAIDFFEKVVMTQNHKFLFSPYFTTDEDSDVKVQ 242
            |..|...|:          .|...||.:||  .:...|:...:.....|.:.|.:.....:..|.
  Rat   441 LLSLTLLAF----------ESLNTATCKDR--CLACIEEPFFSPLWPLLLALYRSVHRTREAAVS 493

  Fly   243 KRIR-------QLSWITAKHLDCSIDEVNSEARDLVYNAISELVGIDSYYS-PQEKLQCTWRCCR 299
            :.:.       ....|..|.|.| :.|  ::|....|...::.:|:....| ||:||:|..|..|
  Rat   494 RSMELYRNALPTALGIPTKLLPC-VPE--AQASTYPYCTAAQELGLLVLESCPQKKLECIVRTLR 555

  Fly   300 HIFELLK--------RATGG---PAS---ADDFLPALIFVVLKANPVRLHSNINFVTRFTNASRL 350
            .|....:        |..||   ||:   |||.||.|.||||::...:|.|....:..||:...|
  Rat   556 VICICAEDYCRAQEARPEGGSQPPAAAIGADDLLPILSFVVLRSGLPQLVSECAALEEFTHEGYL 620

  Fly   351 MSGESGYYFTNLCSAIAFIENLN 373
            : ||.||..|:|.||::::|.|:
  Rat   621 I-GEEGYCLTSLQSALSYVELLS 642

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rabex-5NP_612093.1 zf-A20 17..40 CDD:280010
VPS9 274..373 CDD:280383 39/113 (35%)
Vps9d1XP_006255829.1 VPS9 527..642 CDD:280383 40/115 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343785
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2319
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.