DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rabex-5 and vps902

DIOPT Version :9

Sequence 1:NP_612093.1 Gene:Rabex-5 / 38144 FlyBaseID:FBgn0262937 Length:696 Species:Drosophila melanogaster
Sequence 2:NP_001342780.1 Gene:vps902 / 2540384 PomBaseID:SPBC29A10.11c Length:402 Species:Schizosaccharomyces pombe


Alignment Length:389 Identity:81/389 - (20%)
Similarity:136/389 - (34%) Gaps:144/389 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 PGSSSSVATLDRR----------SPQHAHL-----QGKVEQQVRKPSDKEQDNLGTLQKKKFTAV 108
            |.|:|::.|..:.          ||.|..|     ..|..|...|.:|:               .
pombe    24 PNSASNLPTTVQACVIQFISSLVSPVHPQLLSPEELAKAFQNFYKHTDE---------------F 73

  Fly   109 LQKTLQAGAQKITQQRGHVPDPTEGQFLLQLRQLRIPD--DGKRKLKLEIQRLDSDIRKYMNGNG 171
            :..||             :|.|:...   |...|..|:  |.::|           .|:::....
pombe    74 IASTL-------------IPQPSSKD---QNVPLLFPEEIDAQKK-----------ARQHLLNQK 111

  Fly   172 GKNINELSDLV-QNAYTKVSDIVHNDPSFEIATNED--RDSAIDFFEKVVMTQNHKFLFSPYFTT 233
            .:.::::.|:| :..|.::         |.::|:.|  :|   |..:|.:.::..|.|.:.....
pombe   112 DEWMDQIEDIVCEYLYDRI---------FCLSTSTDAAKD---DLLKKFIASEEKKELINCIPIP 164

  Fly   234 DEDSDVKVQKRIRQLSWITAKHLDCSIDE-------------VNSEARDLVYNAISELVGIDSYY 285
            |   |.|:..|:.::|     ....::||             |||.    :.|| |:|       
pombe   165 D---DEKLTNRLHEVS-----EAFFALDEQHTPRSKINTFMTVNSS----ILNA-SQL------- 209

  Fly   286 SPQEKLQCTWRCCRHIFELLKRATGGPASADDFLPALIFVVLKANPVRLHSNINFVTRFTNASRL 350
             |||:|                      :||..|...|:.:|......|.|::|||.||.||. .
pombe   210 -PQEEL----------------------NADSLLNLTIYCILCYPGFHLISHLNFVLRFRNAD-F 250

  Fly   351 MSGESGYYFTNLCSAIAFI-----ENLNGESLGVSSEEFEALMSGQQPYSTPWESALLACESLH 409
            :|||..|..|...:|:.||     ..|...|:..|.:.....::..:..||        ..|||
pombe   251 LSGEQRYCLTTFEAALTFILRACPNLLTQSSIQPSDDPLSLEVANSETVST--------SNSLH 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rabex-5NP_612093.1 zf-A20 17..40 CDD:280010
VPS9 274..373 CDD:280383 29/103 (28%)
vps902NP_001342780.1 VPS9 173..274 CDD:308039 36/141 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2319
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23101
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.