DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rabex-5 and Zfand5

DIOPT Version :10

Sequence 1:NP_612093.1 Gene:Rabex-5 / 38144 FlyBaseID:FBgn0262937 Length:696 Species:Drosophila melanogaster
Sequence 2:NP_033577.1 Gene:Zfand5 / 22682 MGIID:1278334 Length:213 Species:Mus musculus


Alignment Length:130 Identity:35/130 - (26%)
Similarity:55/130 - (42%) Gaps:19/130 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 CRSGCGFYGTPQNEGLCSMCFREKFNDKQRKLKQTGGETGPGSSSSVATLDRRSPQHAH------ 77
            |.:||||||.|:..|:||:|::|....:|...:.:...|..||:|  .|.|..|.|.|.      
Mouse    14 CSTGCGFYGNPRTNGMCSVCYKEHLQRQQNSGRMSPMGTASGSNS--PTSDSASVQRADAGLNNC 76

  Fly    78 --LQGKVEQQVRK------PSDKEQDNLGTLQKKKFTAVLQKTLQAGAQKITQQRGHVPDPTEGQ 134
              ..|...::.|.      |..::...:...::.|.|.  .|| :.....:||....|..|:..|
Mouse    77 EGAAGSTSEKSRNVPVAALPVTQQMTEMSISREDKITT--PKT-EVSEPVVTQPSPSVSQPSSSQ 138

  Fly   135  134
            Mouse   139  138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rabex-5NP_612093.1 zf-A20 17..40 CDD:460313 12/20 (60%)
DUF5601 163..220 CDD:465668
VPS9 274..373 CDD:460489
Zfand5NP_033577.1 zf-A20 12..35 CDD:460313 12/20 (60%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 39..149 22/105 (21%)
ZnF_AN1 154..191 CDD:197545
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.