DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rabex-5 and Rin1

DIOPT Version :9

Sequence 1:NP_612093.1 Gene:Rabex-5 / 38144 FlyBaseID:FBgn0262937 Length:696 Species:Drosophila melanogaster
Sequence 2:XP_006531773.1 Gene:Rin1 / 225870 MGIID:2385695 Length:798 Species:Mus musculus


Alignment Length:335 Identity:71/335 - (21%)
Similarity:129/335 - (38%) Gaps:88/335 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 GSSSSVATLDRRS-PQHAHLQGKVEQQVRKP--------------SDKEQDNLGT-LQKKKFTAV 108
            |||.|..|..|.| |:|           |:|              .:::.....| |.:.::|||
Mouse   350 GSSGSPTTSPRLSRPRH-----------RRPLLRSMSSAFCSLLAPERQVGRAATMLMQNRYTAV 403

  Fly   109 LQKTLQAGAQKITQQRGHVPDPTE----GQFLLQLRQLRIPDDGKRKLKLEIQRLDSDIRKYMNG 169
            .|..    ...:||.|.. |:|.|    .|.|.:.|.:...:.|..|| |..:||:..:.|.::.
Mouse   404 GQLV----QDLLTQVRAG-PEPRELQGIRQALSRARAMLSAELGPEKL-LPPERLELVLEKSLHR 462

  Fly   170 NGGKNINE-LSDLVQNAYTKVSDIVHNDPSFEIATNEDRDSAIDFFEKVVMTQNHKFLFSPYFTT 233
            :..|.:.. |:..::...:....:......|.:|..:...:          ..:|..|.||..| 
Mouse   463 SVLKPLRPILAARLRRRLSADGSLGRLAEGFRLARTQGPGA----------FGSHLTLSSPVET- 516

  Fly   234 DEDSDVKVQKRIRQLSWITAKHLDCSIDEVNSEARDLVYNAISELVGIDSYYSPQEKLQCTWRCC 298
                     :::||                             :|:.:...|||..:::...:.|
Mouse   517 ---------EQVRQ-----------------------------KLLQLLRAYSPSAQVKWLLQAC 543

  Fly   299 RHIFELLKRATGGPASADDFLPALIFVVLKANPVRLHSNINFVTRFTNASRLMSGESGYYFTNLC 363
            :.::..||...|..|.||:|||.|..|:.:.:...|.....:::.....: |::||.|||.|:|.
Mouse   544 KLLYTALKSQAGENAGADEFLPLLSLVLAQCDLPDLLLEAEYMSELLEPT-LLTGEGGYYLTSLS 607

  Fly   364 SAIAFIENLN 373
            :::|.:..|:
Mouse   608 ASLALLSGLS 617

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rabex-5NP_612093.1 zf-A20 17..40 CDD:280010
VPS9 274..373 CDD:280383 26/98 (27%)
Rin1XP_006531773.1 SH2_RIN1 81..177 CDD:198256
VPS9 513..631 CDD:128469 31/145 (21%)
Ubiquitin_like_fold 649..729 CDD:391949
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167839929
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.