DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rabex-5 and rme-6

DIOPT Version :9

Sequence 1:NP_612093.1 Gene:Rabex-5 / 38144 FlyBaseID:FBgn0262937 Length:696 Species:Drosophila melanogaster
Sequence 2:NP_508208.2 Gene:rme-6 / 180463 WormBaseID:WBGene00004377 Length:1093 Species:Caenorhabditis elegans


Alignment Length:218 Identity:61/218 - (27%)
Similarity:101/218 - (46%) Gaps:25/218 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   165 KYMNGNGGKNINELSDLVQNAYTKVSDIVHNDPSFEIATNEDRDSAIDFFEKVVMTQNHKFLFSP 229
            ||:...     :|.::.::|..|.:.|.:..:..:..||:.....|:...|:.|:...:...|.|
 Worm   890 KYLRAQ-----DERAEFLKNLLTFLRDRLMQNVDWNFATDTMMSRAMTTIERYVIFAVYDNAFYP 949

  Fly   230 YFTTDEDSDVKVQKRIRQLSWITA---------KHLDCSIDEVNSEARDLVYNAISELVGIDSYY 285
            ....|...|..::..|.::|.:..         :||.......:::|         ||..:|.|.
 Worm   950 NRDADHHRDKLLRGTIAKVSDVVTPVNDFLKIPEHLHGEAPWPSAQA---------ELSMLDIYV 1005

  Fly   286 SPQEKLQCTWRCCRHIFELLKRAT-GGPASADDFLPALIFVVLKANPVRLHSNINFVTRFTNASR 349
            :.|:||.|..|||..|..|:..:: ...|||||..|.|:||::||||..|.||:.||..|. ..|
 Worm  1006 TAQDKLNCVVRCCDVINNLVALSSKNAVASADDLTPVLVFVIIKANPRALLSNVQFVETFA-GDR 1069

  Fly   350 LMSGESGYYFTNLCSAIAFIENL 372
            :.||...||:.|..||:.:|:.:
 Worm  1070 IESGRDAYYWVNFKSAVEYIKTI 1092

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rabex-5NP_612093.1 zf-A20 17..40 CDD:280010
VPS9 274..373 CDD:280383 41/100 (41%)
rme-6NP_508208.2 RasGAP_RAP6 93..437 CDD:213331
VPS9 990..1093 CDD:128469 42/113 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D944088at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.