DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rabex-5 and mstr-1

DIOPT Version :10

Sequence 1:NP_612093.1 Gene:Rabex-5 / 38144 FlyBaseID:FBgn0262937 Length:696 Species:Drosophila melanogaster
Sequence 2:NP_001369930.1 Gene:mstr-1 / 172441 WormBaseID:WBGene00009050 Length:189 Species:Caenorhabditis elegans


Alignment Length:74 Identity:21/74 - (28%)
Similarity:34/74 - (45%) Gaps:0/74 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 CRSGCGFYGTPQNEGLCSMCFREKFNDKQRKLKQTGGETGPGSSSSVATLDRRSPQHAHLQGKVE 83
            ||:||||:|....||.||.||:.....:|..::.|.....|.|.::.::..:..|....:..|..
 Worm    14 CRAGCGFFGASATEGYCSQCFKNTLKRQQDTVRLTSPVVSPSSMAATSSALKSEPSSVDMCMKAA 78

  Fly    84 QQVRKPSDK 92
            ..|...:.|
 Worm    79 VSVSDETAK 87

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rabex-5NP_612093.1 zf-A20 17..40 CDD:460313 12/20 (60%)
DUF5601 163..220 CDD:465668
VPS9 274..373 CDD:460489
mstr-1NP_001369930.1 zf-A20 14..35 CDD:460313 12/20 (60%)
ZnF_AN1 130..167 CDD:197545
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.