DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rabex-5 and zfand4

DIOPT Version :9

Sequence 1:NP_612093.1 Gene:Rabex-5 / 38144 FlyBaseID:FBgn0262937 Length:696 Species:Drosophila melanogaster
Sequence 2:NP_001189400.1 Gene:zfand4 / 100148477 ZFINID:ZDB-GENE-090312-102 Length:673 Species:Danio rerio


Alignment Length:432 Identity:96/432 - (22%)
Similarity:155/432 - (35%) Gaps:105/432 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 KQRKLKQTGGETGPGSSSSVATLDRRSPQHAHLQGKVEQQVRKPSDKEQDNLGTLQKKKFTAVLQ 110
            |..||| .....||...|.    ...|.:| |...:|..|:...|......:|..|:.     :.
Zfish   225 KTAKLK-IRPPVGPRPCSG----SHGSARH-HRMFRVLPQIGHASSTHLPPIGDQQQP-----VL 278

  Fly   111 KTLQAG---------AQKITQQRGHVPDPTEGQFLLQLRQLRIPDDG--KRKLKL--EIQRLDSD 162
            .|..||         :...:..|.|......|.::||..:   |.|.  .||::|  ::.|||..
Zfish   279 STPTAGSAHQPYTSLSSPASSSRAHPSSAASGIYMLQAEE---PWDNPVPRKIRLPPKVSRLDMR 340

  Fly   163 IRKYMNGNGGKNINELSDLVQNAYTKVSDIVHNDPSFEIATNEDRDSAIDF-FEKVVMTQNHKFL 226
            ..|.|.                      |.|:  |...:.::......:|. .|.:.:|:....:
Zfish   341 GPKVMR----------------------DCVY--PPLSLLSSPGVQDEVDIKNEHLTLTEKTTVI 381

  Fly   227 FSPY---FTTDE--DSDVKVQKRIRQLSWITAKHLDCSIDEVNSEARDLVYNAISELVGIDSYYS 286
            .||.   |...|  ..||..| |.|.|:.:|       :.|.|:.|     ..:|:.|..:....
Zfish   382 ESPKAVPFNLPEPLSLDVSAQ-RERSLNSLT-------MPEANAAA-----PLLSQAVNSNWRLP 433

  Fly   287 PQEKLQCT---WRCCRHIFELLKRATGGPASADDFLPALIFVVLKANP-VRLHSNINFVTRFTNA 347
            .|..|..|   :...|| ||.    ||....     |:....:|:.:| :.:.|......:....
Zfish   434 SQHDLTLTTEPFTPPRH-FEF----TGSSVH-----PSPSHALLRTSPSLPISSPSKTTFKVDKH 488

  Fly   348 SRLMSGESGYYFTNLCSAIAFIENLNGESLG-VSSEEFEALMS---GQQPYSTPWESALLAC--- 405
            |.::|.......|||.:      ....|.|| ||:.|..|.::   ||:..::|:....|..   
Zfish   489 SEVISKSEARDITNLAN------KATKEPLGSVSNAELLASLAGSGGQETLTSPYALGRLCATAA 547

  Fly   406 ---ESLHLISEN-MKRMEMLQKRNALI----SSGITSFEKEL 439
               .::||:.|: ::|:..||:.....    |||::|..|.|
Zfish   548 PLPNNIHLLQEDLLRRISPLQRTAGFTASSSSSGLSSSIKRL 589

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rabex-5NP_612093.1 zf-A20 17..40 CDD:280010
VPS9 274..373 CDD:280383 20/102 (20%)
zfand4NP_001189400.1 AN1_N 1..103 CDD:176397
UBQ 28..99 CDD:214563
ZnF_AN1 613..651 CDD:197545
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3173
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.