DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32333 and LPL1

DIOPT Version :9

Sequence 1:NP_001261246.1 Gene:CG32333 / 38142 FlyBaseID:FBgn0052333 Length:1499 Species:Drosophila melanogaster
Sequence 2:NP_014702.1 Gene:LPL1 / 854225 SGDID:S000005585 Length:450 Species:Saccharomyces cerevisiae


Alignment Length:227 Identity:54/227 - (23%)
Similarity:95/227 - (41%) Gaps:21/227 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly  1232 HLVICVHGLDGNSADLRLVRTYLELGL--PGVN---LEFLMSERNQGDTFSDFDTMTDRLVTEIL 1291
            ||.:.:|||.||...:..:||.|...|  ..||   :.||..:.....||...:.:..|.:.|:.
Yeast     6 HLFVLIHGLWGNYTHMESMRTILSTTLKKEDVNDDMIYFLPKQNAMFKTFDGIEIIGYRTLIEVC 70

  Fly  1292 YHI-DSCALNPARISFVAHSLGTIIVRSALAR--PQMRPLL----PRLHTFLSLSGPHLGT-LYN 1348
            ..| |.......::|.:.:|.|.::.|..:.:  .:.:.|.    |:|  |::::.||||. .||
Yeast    71 EFIRDYKDGKITKLSVMGYSQGGLVARFMIGKMLTEFKELFEDIEPQL--FITMATPHLGVEFYN 133

  Fly  1349 TSGLVNMGMWFMQKWKKSGSLLQLCMRD--TTDMRNSFLYRLSQ---RSTLHHFK-NILLCGSSQ 1407
            .:|:......:........::|....|:  ..:..|:.|.:|||   ...|..|| .|.......
Yeast   134 PTGIAYKSALYSALRTLGSTILGKSGREMFIANSSNNILVKLSQGEYLEALSLFKWRIAFANVKN 198

  Fly  1408 DRYVPAHSARLELCKAAMRDSSSLGTIYREMV 1439
            ||.|..::|.:..|...:...:.|...:.|.:
Yeast   199 DRTVAFYTAFITDCDPFIDFDNKLKYTFEEKI 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32333NP_001261246.1 DUF3657 150..226 CDD:289180
MhpC 1223..>1447 CDD:223669 54/227 (24%)
DUF676 1227..1422 CDD:282860 51/208 (25%)
LPL1NP_014702.1 DUF676 5..209 CDD:309968 51/204 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3354
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.