Sequence 1: | NP_001261246.1 | Gene: | CG32333 / 38142 | FlyBaseID: | FBgn0052333 | Length: | 1499 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_010174.1 | Gene: | YDL109C / 851449 | SGDID: | S000002267 | Length: | 647 | Species: | Saccharomyces cerevisiae |
Alignment Length: | 269 | Identity: | 62/269 - (23%) |
---|---|---|---|
Similarity: | 98/269 - (36%) | Gaps: | 93/269 - (34%) |
- Green bases have known domain annotations that are detailed below.
Fly 1232 HLVICVHGLDGN-SADLRLVRTYLELGLPGVNLEFLMSERNQGDTFSDFDTMTDRLVTEILYHID 1295
Fly 1296 SCAL----------------------NPARISFVAHSLGTIIVRSALAR---------PQMRPLL 1329
Fly 1330 PRLHTFLSLSGPHLGTLYNTSGLVNMGMWFMQKWKKSGSLL-----QLCMRDTTDMRNSFLYRLS 1389
Fly 1390 QR---STLHHFK-NILLCGSSQDRYVPAHSARLELCKAAMRDSSSLGTIYREMVHNI----IAPI 1446
Fly 1447 --LARPELT 1453 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG32333 | NP_001261246.1 | DUF3657 | 150..226 | CDD:289180 | |
MhpC | 1223..>1447 | CDD:223669 | 59/261 (23%) | ||
DUF676 | 1227..1422 | CDD:282860 | 53/230 (23%) | ||
YDL109C | NP_010174.1 | DUF676 | 189..387 | CDD:309968 | 54/238 (23%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C157341325 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |