DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32333 and YDL109C

DIOPT Version :9

Sequence 1:NP_001261246.1 Gene:CG32333 / 38142 FlyBaseID:FBgn0052333 Length:1499 Species:Drosophila melanogaster
Sequence 2:NP_010174.1 Gene:YDL109C / 851449 SGDID:S000002267 Length:647 Species:Saccharomyces cerevisiae


Alignment Length:269 Identity:62/269 - (23%)
Similarity:98/269 - (36%) Gaps:93/269 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly  1232 HLVICVHGLDGN-SADLRLVRTYLELGLPGVNLEFLMSERNQGDTFSDFDTMTDRLVTEILYHID 1295
            ||||..||...| |||                :|:||.|..:    :..:...:|||.: .|..:
Yeast   194 HLVILTHGFQSNVSAD----------------MEYLMEEIYK----AQMNNPNERLVIK-GYMKN 237

  Fly  1296 SCAL----------------------NPARISFVAHSLGTIIVRSALAR---------PQMRPLL 1329
            :|..                      :..:|||:.||||.:....|:..         .::.|: 
Yeast   238 ACETEKGIKFLGVGLANYIIDELYDDSVGKISFIGHSLGGLTQTFAICYIKTKYPYFFKKVEPI- 301

  Fly  1330 PRLHTFLSLSGPHLGTLYNTSGLVNMGMWFMQKWKKSGSLL-----QLCMRDTTDMRNSFLYRLS 1389
                .|:||:.|.||...:|...|.|.:        |..::     :|.::|........||.||
Yeast   302 ----NFISLASPLLGIATSTPNYVKMSL--------SMGIIGTTGQELGLKDGNYGDKPLLYLLS 354

  Fly  1390 QR---STLHHFK-NILLCGSSQDRYVPAHSARLELCKAAMRDSSSLGTIYREMVHNI----IAPI 1446
            :.   |.|..|| ..|...:..|..||.:|            ||.|...|.:::..:    .||.
Yeast   355 EESLISVLARFKRRTLYANAVNDGIVPLYS------------SSLLFLDYSQLLQKLGGQTTAPC 407

  Fly  1447 --LARPELT 1453
              |.:||::
Yeast   408 DPLFQPEVS 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32333NP_001261246.1 DUF3657 150..226 CDD:289180
MhpC 1223..>1447 CDD:223669 59/261 (23%)
DUF676 1227..1422 CDD:282860 53/230 (23%)
YDL109CNP_010174.1 DUF676 189..387 CDD:309968 54/238 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157341325
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.