DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tfc and REG4

DIOPT Version :9

Sequence 1:NP_612091.1 Gene:tfc / 38141 FlyBaseID:FBgn0035199 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001152824.1 Gene:REG4 / 83998 HGNCID:22977 Length:158 Species:Homo sapiens


Alignment Length:126 Identity:31/126 - (24%)
Similarity:56/126 - (44%) Gaps:13/126 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   253 GIFFK-ANWFKATQYCRYH--GMHLASISSQEENDRLEKHIRDFGLGHEHFWISGTDLADEGNFF 314
            |.|.| .||..|...|:.:  |.|||||.|.:|...:.::|..:... :..||...|......:.
Human    43 GYFRKLRNWSDAELECQSYGNGAHLASILSLKEASTIAEYISGYQRS-QPIWIGLHDPQKRQQWQ 106

  Fly   315 WMATGRPITFTNWNAGEPNNFRYENGEEENCLELWNRDGKGLKWNDSPCSFETYFVCEVQP 375
            |: .|....:.:|:.       ...|..::|.|: :.:...|.|:.:.|:...:|:|:.:|
Human   107 WI-DGAMYLYRSWSG-------KSMGGNKHCAEM-SSNNNFLTWSSNECNKRQHFLCKYRP 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tfcNP_612091.1 CLECT 249..373 CDD:153057 30/122 (25%)
REG4NP_001152824.1 CLECT_REG-1_like 30..156 CDD:153064 30/122 (25%)
Carbohydrate-binding 98..103 1/4 (25%)
Carbohydrate-binding 135..137 0/1 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BFQ9
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.