DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tfc and Clec4a3

DIOPT Version :9

Sequence 1:NP_612091.1 Gene:tfc / 38141 FlyBaseID:FBgn0035199 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001191170.1 Gene:Clec4a3 / 73149 MGIID:1920399 Length:237 Species:Mus musculus


Alignment Length:150 Identity:39/150 - (26%)
Similarity:59/150 - (39%) Gaps:34/150 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   235 PNKWTMPLLKLGEKRYYLGIFFKANWFKATQYCRYHGMHLASISSQEENDRLEKHIRDFGLGH-- 297
            |..|.    ..|...|:......|:|.::.:.|.:.|.||..|.||||.|.: ..|.|.|..:  
Mouse   108 PKDWK----PFGSYCYFTSTDLVASWNESKENCFHMGAHLVVIHSQEEQDFI-TGILDTGTAYFI 167

  Fly   298 --------EHFWISGTDLADEGNFFWMATGRPITFTNWNAGEPNNFRYENGEEENCLELWNRDGK 354
                    :..||..|...|...|             |:.|||::      :.|.|:.:.:|...
Mouse   168 GLSNPGDQQWQWIDQTPYDDNTTF-------------WHKGEPSS------DNEQCVIINHRQST 213

  Fly   355 GLKWNDSPCSFETYFVCEVQ 374
            |..|:|.|||.:...:|.|:
Mouse   214 GWGWSDIPCSDKQNSICHVK 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tfcNP_612091.1 CLECT 249..373 CDD:153057 35/133 (26%)
Clec4a3NP_001191170.1 DUF2418 41..>82 CDD:287321
CLECT_DC-SIGN_like 107..230 CDD:153060 37/145 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167840883
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BFQ9
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.