DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tfc and SFTPA2

DIOPT Version :9

Sequence 1:NP_612091.1 Gene:tfc / 38141 FlyBaseID:FBgn0035199 Length:376 Species:Drosophila melanogaster
Sequence 2:XP_005270185.1 Gene:SFTPA2 / 729238 HGNCID:10799 Length:265 Species:Homo sapiens


Alignment Length:136 Identity:37/136 - (27%)
Similarity:66/136 - (48%) Gaps:24/136 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   242 LLKLGEKRYYLGIFFKAN----WFKATQ-YCRYHGMHLASISSQEENDRLEKHIRDFGLGHEHFW 301
            ::.:|||      .|.:|    .|.|.| .|...|..:|...:.|||:.:...::.:   :.:.:
Human   148 IMTVGEK------VFSSNGQSITFDAIQEACARAGGRIAVPRNPEENEAIASFVKKY---NTYAY 203

  Fly   302 ISGTDLADEGNFFWMATGRPITFTNWNAGEPNNFRYENGEEENCLELWNRDGKGLKWNDSPCSFE 366
            :..|:....|:|.: :.|.|:.:|||..|||..    .|:|: |:|::. ||   :|||..|.:.
Human   204 VGLTEGPSPGDFRY-SDGTPVNYTNWYRGEPAG----RGKEQ-CVEMYT-DG---QWNDRNCLYS 258

  Fly   367 TYFVCE 372
            ...:||
Human   259 RLTICE 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tfcNP_612091.1 CLECT 249..373 CDD:153057 34/129 (26%)
SFTPA2XP_005270185.1 Collagen 45..117 CDD:189968
CLECT_collectin_like 153..265 CDD:153061 36/131 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.