DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tfc and CLEC19A

DIOPT Version :9

Sequence 1:NP_612091.1 Gene:tfc / 38141 FlyBaseID:FBgn0035199 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001243649.1 Gene:CLEC19A / 728276 HGNCID:34522 Length:186 Species:Homo sapiens


Alignment Length:136 Identity:42/136 - (30%)
Similarity:64/136 - (47%) Gaps:26/136 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   255 FFKAN--WFKATQYCRYHGM-----HLASISSQEEN----DRLEKHI----RDFGLG-HEHFWIS 303
            ||..|  |.:|..||....:     .||||.|.|||    |.:...:    .|...| |:|    
Human    54 FFPLNKTWAEADLYCSEFSVGRKSAKLASIHSWEENVFVYDLVNSCVPGIPADVWTGLHDH---- 114

  Fly   304 GTDLADEGNFFWMATGRPITFTNWNAGEPNNFRYENGEEENCLELWNRDGKGLK-WNDSPCSFET 367
                ..||.|.| ..|....::.|:..:|::..:.:.|||:|:::|.|....|: |||:.||.:.
Human   115 ----RQEGQFEW-TDGSSYDYSYWDGSQPDDGVHADPEEEDCVQIWYRPTSALRSWNDNTCSRKF 174

  Fly   368 YFVCEV 373
            .|||::
Human   175 PFVCKI 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tfcNP_612091.1 CLECT 249..373 CDD:153057 42/134 (31%)
CLEC19ANP_001243649.1 CLECT_CEL-1_like 40..180 CDD:153059 42/134 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.