DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tfc and Clec4b1

DIOPT Version :10

Sequence 1:NP_612091.1 Gene:tfc / 38141 FlyBaseID:FBgn0035199 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001177239.1 Gene:Clec4b1 / 69810 MGIID:1917060 Length:209 Species:Mus musculus


Alignment Length:101 Identity:23/101 - (22%)
Similarity:49/101 - (48%) Gaps:17/101 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 YVRIMRELEDMKQELSKLKLD-VVYVSRE-----KVVAEK-EVMELESRMEE--NLKLLESLKLE 162
            ::.:..:||.::..:..:.:| .:|...:     ||.|.. .::||:..:.|  |:.|.|:::..
Mouse    50 WIDVRYDLEKIESLIQFIHIDTTLYTDSDFHPSCKVTAMNCFLLELQVILHEYSNMTLNETVRNV 114

  Fly   163 VDVAN----EEHVLVEVAKIEALKECKEVEEQREKE 194
            :.:||    ....::|    ...|||:|:||:...|
Mouse   115 LYLANSTLSSNKNVIE----SGCKECEELEERNFTE 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tfcNP_612091.1 CLECT 249..373 CDD:153057
Clec4b1NP_001177239.1 CLECT_DC-SIGN_like 78..204 CDD:153060 19/73 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.