DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tfc and Cd209f

DIOPT Version :9

Sequence 1:NP_612091.1 Gene:tfc / 38141 FlyBaseID:FBgn0035199 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_081232.2 Gene:Cd209f / 69142 MGIID:1916392 Length:255 Species:Mus musculus


Alignment Length:205 Identity:54/205 - (26%)
Similarity:91/205 - (44%) Gaps:36/205 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 QERDQQPLANQEDFDYDVQESLQSVESEQHDQYYGNIFHRDPSENEVDNDCPNCVDESQYTPNKW 238
            |.:|||..::.:......:::...:|..|..|.....|:.     .:...|..|       |..|
Mouse    79 QTQDQQGSSSLDKVAVPREQTHSGLEQIQQIQQQLTQFNA-----SLAGLCRPC-------PWDW 131

  Fly   239 TMPLLKLGEKRYYLGIFFKANWFKATQYCRYHGMHLASISSQEENDRLEKH--IRDFGLGHEHFW 301
                 :|.:...||......:|..:...|...|.||..::|..| .|..|:  :|.    ::..|
Mouse   132 -----ELFQGSCYLFSRTLGSWETSASSCEDLGAHLVIVNSVSE-QRFMKYWNVRK----NQRSW 186

  Fly   302 ISGTDLADEGNFFWMATGRPITFTNWNAGEPNNFRYENGEEENCLELWNRDGKGLKWNDSPCSFE 366
            |..:|...||::.|: .|..:.|:.|..|||||    :|:|: |:||:..|     |||:.|:.:
Mouse   187 IGLSDHIHEGSWQWV-DGSALKFSFWKEGEPNN----DGDED-CVELFMDD-----WNDNKCTEQ 240

  Fly   367 TYFVCEVQPN 376
            .::||| ||:
Mouse   241 NFWVCE-QPS 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tfcNP_612091.1 CLECT 249..373 CDD:153057 38/125 (30%)
Cd209fNP_081232.2 CLECT_DC-SIGN_like 127..246 CDD:153060 41/146 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BFQ9
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.