DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tfc and Cd209c

DIOPT Version :9

Sequence 1:NP_612091.1 Gene:tfc / 38141 FlyBaseID:FBgn0035199 Length:376 Species:Drosophila melanogaster
Sequence 2:XP_006248854.1 Gene:Cd209c / 688951 RGDID:1582956 Length:240 Species:Rattus norvegicus


Alignment Length:188 Identity:48/188 - (25%)
Similarity:77/188 - (40%) Gaps:49/188 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   196 QSVESEQHDQYYGNIFHRDPSENEVDNDCP--------NCVDESQYTPNKWTMPLLKLGEKRYYL 252
            |..|..:.::.|.::....|..|.:...||        ||                       |.
  Rat    82 QGQEQAKKEKVYQDVAQLKPQINHLCRPCPWDWTFFQGNC-----------------------YF 123

  Fly   253 GIFFKANWFKATQYCRYHGMHLASISSQEENDRLEKHIRDFGLGHEHFWISGTDLADEGNFFWMA 317
            ...|:.||..:...||..|..|..:.|.:|...|::..::.|    :.|:..:||..||.:.|: 
  Rat   124 FSKFQQNWKDSVTSCRKLGAQLVVVKSDDEQSFLQQTSKEKG----YAWMVLSDLKREGIWHWV- 183

  Fly   318 TGRPITFT---NWNAGEPNNFRYENGEEENCLELWNRDGKGLKWNDSPCSFETYFVCE 372
            .|..:.|:   .||.||||     |..||:|.|.     :|..|||:||:.:.|::|:
  Rat   184 DGSHLLFSFTKYWNKGEPN-----NEWEEDCAEF-----RGDGWNDAPCTNKKYWICK 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tfcNP_612091.1 CLECT 249..373 CDD:153057 39/127 (31%)
Cd209cXP_006248854.1 CLECT_DC-SIGN_like 110..232 CDD:153060 43/160 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.