DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tfc and Cd209f

DIOPT Version :9

Sequence 1:NP_612091.1 Gene:tfc / 38141 FlyBaseID:FBgn0035199 Length:376 Species:Drosophila melanogaster
Sequence 2:XP_001068161.4 Gene:Cd209f / 688750 RGDID:1585258 Length:277 Species:Rattus norvegicus


Alignment Length:120 Identity:40/120 - (33%)
Similarity:59/120 - (49%) Gaps:17/120 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   258 ANWFKATQYCRYHGMHLASISSQEENDRLEK-HIRDFGLGHEHFWISGTDLADEGNFFWMATGRP 321
            |:|..:...|:..|.||..::|..|...|:. |||...|    .||..:|...||::.|: ...|
  Rat   162 ASWGASASSCKDLGAHLVIVNSVAEQQFLKYWHIRQSQL----TWIGLSDHQREGSWQWV-DDTP 221

  Fly   322 ITFTNWNAGEPNNFRYENGEEENCLELWNRDGKGLKWNDSPCSFETYFVCEVQPN 376
            :..:.|..||||     |..:|:|:.:...     |||||.||...::||| ||:
  Rat   222 LKLSFWKEGEPN-----NAGDEDCVVIAED-----KWNDSTCSANNFWVCE-QPS 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tfcNP_612091.1 CLECT 249..373 CDD:153057 37/115 (32%)
Cd209fXP_001068161.4 CLECT_DC-SIGN_like 143..262 CDD:153060 36/114 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BFQ9
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.