DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tfc and illr1

DIOPT Version :9

Sequence 1:NP_612091.1 Gene:tfc / 38141 FlyBaseID:FBgn0035199 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001035139.1 Gene:illr1 / 677756 ZFINID:ZDB-GENE-050311-2 Length:253 Species:Danio rerio


Alignment Length:199 Identity:53/199 - (26%)
Similarity:85/199 - (42%) Gaps:32/199 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   181 LANQEDFDYDVQESLQSVESEQHDQYYGNIFHRDPSENEVDNDCPNCVDESQYTPNKWTMPLLKL 245
            :::||....|..|.| .|...||.:....:...:.|     :.|..|.       .:||    ..
Zfish    75 VSDQEHNVTDYMEQL-DVLRIQHQETLRKLNRLNQS-----SGCALCA-------VRWT----HS 122

  Fly   246 GEKRYYLGIFFKANWFKATQYCRYHGMHLASISSQEENDRLEKHIRDFGLGHEHFWISGTDLADE 310
            |.|.||... .|.||.::..:|...|.||..|:|:.|.|.|..:::      |..||...||..|
Zfish   123 GGKCYYFST-VKMNWTQSRDHCVTKGGHLVIITSKAEQDFLTSNVK------ETHWIGLNDLDTE 180

  Fly   311 GNFFWMATGRPI--TFTNW-----NAGEPNNFRYENGEEENCLELWNRDGKGLKWNDSPCSFETY 368
            |::.|: ..:|:  |...|     ...||:|:..::.:.|:|..|.:..|:...|.|:.|..:..
Zfish   181 GHWIWV-DNQPLSQTVEFWIKRENGVREPDNWTKQHVDGEDCASLGHPGGETDFWTDAYCFQKKR 244

  Fly   369 FVCE 372
            |:||
Zfish   245 FICE 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tfcNP_612091.1 CLECT 249..373 CDD:153057 38/131 (29%)
illr1NP_001035139.1 CLECT_DC-SIGN_like 115..248 CDD:153060 41/151 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.