DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tfc and illr3

DIOPT Version :9

Sequence 1:NP_612091.1 Gene:tfc / 38141 FlyBaseID:FBgn0035199 Length:376 Species:Drosophila melanogaster
Sequence 2:XP_021323809.1 Gene:illr3 / 677740 ZFINID:ZDB-GENE-050311-4 Length:285 Species:Danio rerio


Alignment Length:142 Identity:46/142 - (32%)
Similarity:68/142 - (47%) Gaps:19/142 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   238 WTMPLLKLGEKRYYLGIFFKANWFKATQYCRYHGMHLASISSQEENDRLEKHIRDFGLGHEHFWI 302
            ||    ..|||.||... .|.||.::..:|...|.||..|:||.|.:.|..:::      |..||
Zfish   151 WT----HSGEKCYYFST-VKMNWTQSRDHCVTKGGHLVIITSQAEQEFLTSNVK------ETHWI 204

  Fly   303 SGTDLADEGNFFWMATGRPITFTN--W-----NAGEPNNFRYENGEEENCLELWNRDGKGLKWND 360
            ...||..||.:.|: ..:|::.|.  |     ...||:|:..::.:.|:|..|.:.||:...|.|
Zfish   205 GLNDLDTEGRWLWV-DNQPLSQTEEFWMKRENGVSEPDNWTKQHVDGEDCASLGHPDGETDFWTD 268

  Fly   361 SPCSFETYFVCE 372
            :.|..|..||||
Zfish   269 AYCFEEKRFVCE 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tfcNP_612091.1 CLECT 249..373 CDD:153057 41/131 (31%)
illr3XP_021323809.1 CLECT_DC-SIGN_like 147..280 CDD:153060 44/140 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.