DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tfc and Mbl2

DIOPT Version :10

Sequence 1:NP_612091.1 Gene:tfc / 38141 FlyBaseID:FBgn0035199 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_073195.2 Gene:Mbl2 / 64668 RGDID:67380 Length:244 Species:Rattus norvegicus


Alignment Length:139 Identity:45/139 - (32%)
Similarity:62/139 - (44%) Gaps:20/139 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   237 KWTMPLLKLGE---KRYYLGIFFKANWFKATQYCRYHGMHLASISSQEENDRLEKHIRDFGLGHE 298
            ||.  ||.:.|   |:|::....:....:|...|......:|:..:.|||..::...:|..    
  Rat   120 KWV--LLSMSENVGKKYFMSSVRRMPLNRAKALCSELQGTVATPRNAEENRAIQNVAKDVA---- 178

  Fly   299 HFWISGTDLADEGNFFWMATGRPITFTNWNAGEPNNFRYENGEEENCLELWNRDGKGLKWNDSPC 363
              ::..||...| |.|...||..:.:||||.|||||.    |..|||:.|....    ||||.||
  Rat   179 --FLGITDQRTE-NVFEDLTGNRVRYTNWNEGEPNNV----GSGENCVVLLTNG----KWNDVPC 232

  Fly   364 SFETYFVCE 372
            |.....|||
  Rat   233 SDSFLVVCE 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tfcNP_612091.1 CLECT 249..373 CDD:153057 39/124 (31%)
Mbl2NP_073195.2 Collagen 36..95 CDD:460189
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 43..99
CLECT_collectin_like 132..242 CDD:153061 40/125 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.