DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tfc and SFTPD

DIOPT Version :9

Sequence 1:NP_612091.1 Gene:tfc / 38141 FlyBaseID:FBgn0035199 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_003010.4 Gene:SFTPD / 6441 HGNCID:10803 Length:375 Species:Homo sapiens


Alignment Length:297 Identity:71/297 - (23%)
Similarity:109/297 - (36%) Gaps:83/297 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 DILPKPKPSPR----PR-------------PRGFAASDG-----------GNFKRSGGGAQRNRL 145
            :|.|:.||.|:    |:             .||.|...|           ||...:|........
Human   128 NIGPQGKPGPKGEAGPKGEVGAPGMQGSAGARGLAGPKGERGVPGERGVPGNTGAAGSAGAMGPQ 192

  Fly   146 AAAASKRQSGYNRKRLREEQEEEEEADDQERDQQPLANQEDFDYDVQESLQSVESEQHDQYYGNI 210
            .:..::...|.       :.::....|...:.:..|.       ||....|.||:.|     |.:
Human   193 GSPGARGPPGL-------KGDKGIPGDKGAKGESGLP-------DVASLRQQVEALQ-----GQV 238

  Fly   211 FHRDPSENEVDNDCPNCVDESQYT-----PNKWTMPLLKLGEKRYYLGIFFKANWFKATQYCRYH 270
            .|...:             .|||.     ||..:     :|||.:....|.|. :.:|...|...
Human   239 QHLQAA-------------FSQYKKVELFPNGQS-----VGEKIFKTAGFVKP-FTEAQLLCTQA 284

  Fly   271 GMHLASISSQEENDRLEKHIRDFGLGHEHFWISGTDLADEGNFFWMATGRPITFTNWNAGEPNNF 335
            |..|||..|..||..|::.:   ...:|..::|.||...||.|.: .||..:.::||..||||  
Human   285 GGQLASPRSAAENAALQQLV---VAKNEAAFLSMTDSKTEGKFTY-PTGESLVYSNWAPGEPN-- 343

  Fly   336 RYENGEEENCLELWNRDGKGLKWNDSPCSFETYFVCE 372
              ::|..|:|:|::...    ||||..|..:...|||
Human   344 --DDGGSEDCVEIFTNG----KWNDRACGEKRLVVCE 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tfcNP_612091.1 CLECT 249..373 CDD:153057 39/124 (31%)
SFTPDNP_003010.4 Collagen 46..98 CDD:189968
Collagen 130..201 CDD:189968 12/70 (17%)
Surfac_D-trimer 224..269 CDD:286141 15/67 (22%)
CLECT_collectin_like 262..375 CDD:153061 41/126 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.