DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tfc and Clec10a

DIOPT Version :9

Sequence 1:NP_612091.1 Gene:tfc / 38141 FlyBaseID:FBgn0035199 Length:376 Species:Drosophila melanogaster
Sequence 2:XP_008766090.1 Gene:Clec10a / 64195 RGDID:621158 Length:307 Species:Rattus norvegicus


Alignment Length:117 Identity:34/117 - (29%)
Similarity:57/117 - (48%) Gaps:13/117 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   260 WFKATQYCRYHGMHLASISSQEENDRLEKHIRDFGLGHEHFWISGTDLADEGNFFWM-ATGRPIT 323
            |.:|.:||:....:|.:::|..|.:.|:.|     :|....||..||  ..|.:.|: .|.....
  Rat   197 WPEADKYCQLENSNLVAVNSLAEQNFLQTH-----MGSVVTWIGLTD--QNGPWRWVDGTDYEKG 254

  Fly   324 FTNWNAGEPNN-FRYENGEEENCLELWNRDGKGLKWNDSPCSFETYFVCEVQ 374
            ||:|...:|:| :.:..|..|:|.. :..||   :|||..|.....:|||::
  Rat   255 FTHWAPKQPDNWYGHGLGGGEDCAH-FTSDG---RWNDDVCQRPYRWVCEMK 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tfcNP_612091.1 CLECT 249..373 CDD:153057 33/114 (29%)
Clec10aXP_008766090.1 Lectin_N 21..166 CDD:281887
Apolipoprotein <63..166 CDD:279749
CLECT_DC-SIGN_like 176..301 CDD:153060 33/114 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344387
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5163
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.980

Return to query results.
Submit another query.