DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tfc and Clec10a

DIOPT Version :10

Sequence 1:NP_612091.1 Gene:tfc / 38141 FlyBaseID:FBgn0035199 Length:376 Species:Drosophila melanogaster
Sequence 2:XP_008766090.1 Gene:Clec10a / 64195 RGDID:621158 Length:307 Species:Rattus norvegicus


Alignment Length:117 Identity:34/117 - (29%)
Similarity:57/117 - (48%) Gaps:13/117 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   260 WFKATQYCRYHGMHLASISSQEENDRLEKHIRDFGLGHEHFWISGTDLADEGNFFWM-ATGRPIT 323
            |.:|.:||:....:|.:::|..|.:.|:.|     :|....||..||  ..|.:.|: .|.....
  Rat   197 WPEADKYCQLENSNLVAVNSLAEQNFLQTH-----MGSVVTWIGLTD--QNGPWRWVDGTDYEKG 254

  Fly   324 FTNWNAGEPNN-FRYENGEEENCLELWNRDGKGLKWNDSPCSFETYFVCEVQ 374
            ||:|...:|:| :.:..|..|:|.. :..||   :|||..|.....:|||::
  Rat   255 FTHWAPKQPDNWYGHGLGGGEDCAH-FTSDG---RWNDDVCQRPYRWVCEMK 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tfcNP_612091.1 CLECT 249..373 CDD:153057 33/114 (29%)
Clec10aXP_008766090.1 Lectin_N 5..166 CDD:461106
CLECT_DC-SIGN_like 176..301 CDD:153060 33/114 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.