DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tfc and clec19a

DIOPT Version :9

Sequence 1:NP_612091.1 Gene:tfc / 38141 FlyBaseID:FBgn0035199 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001315005.1 Gene:clec19a / 570145 ZFINID:ZDB-GENE-080917-46 Length:207 Species:Danio rerio


Alignment Length:175 Identity:50/175 - (28%)
Similarity:75/175 - (42%) Gaps:27/175 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   215 PSEN-EVDNDCPNCVDESQY---TPNKWTMPLLKLGEKRYYLGIFFKAN--WFKATQYCR----- 268
            ||.| ::....|..:.:|..   .|..||       |...|...||..|  |.:|..||.     
Zfish    39 PSTNIKITQALPMQLSDSNQPVTCPLFWT-------EFEGYCYRFFPLNRTWAEADLYCAEFSNG 96

  Fly   269 YHGMHLASISSQEEN----DRLEKHIRDFGLGHEHFWISGTDLADEGNFFWMATGRPITFTNWNA 329
            :....|.|:.|.|||    |.:...:.  |:..: .||...|...||...| ..|.|..::.|:.
Zfish    97 HKSAKLTSVHSWEENVFVYDLVNSRMP--GIPTD-IWIGLHDRRQEGTMEW-TDGSPFEYSYWDG 157

  Fly   330 GEPNNFRYENGEEENCLELWNRDGKGLK-WNDSPCSFETYFVCEV 373
            .:|::..:...|||:|:|:|.|....|: |||:.|.....|||::
Zfish   158 NQPDDGIHRIPEEEDCVEIWYRQNSALRSWNDNNCDKAFPFVCKI 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tfcNP_612091.1 CLECT 249..373 CDD:153057 41/135 (30%)
clec19aNP_001315005.1 CLECT_CEL-1_like 62..202 CDD:153059 45/150 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.