DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tfc and zgc:174904

DIOPT Version :9

Sequence 1:NP_612091.1 Gene:tfc / 38141 FlyBaseID:FBgn0035199 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001170922.1 Gene:zgc:174904 / 564690 ZFINID:ZDB-GENE-080204-76 Length:320 Species:Danio rerio


Alignment Length:274 Identity:61/274 - (22%)
Similarity:107/274 - (39%) Gaps:65/274 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 KRSGGGAQRNRLAAAASKRQSGYNRKRL--------REEQEEEEEADDQERDQQPLANQEDFDYD 190
            |.|..|...:..||||.::....|...|        ||:.|.|::..:.|:.::.|..::.   :
Zfish    72 KTSSSGQGSSSSAAAAHQQTGSINVTALTTELQTAKREKSELEKDKSELEKKKRELEKEKS---E 133

  Fly   191 VQESLQSVESEQHDQYYGNIFHRDPSENEVD-NDCPNCVDESQYTPNKWTMPL----------LK 244
            :::....:|..:.:      ..::.||.:.: ....:.|.:.:.||...|.|.          ..
Zfish   134 LEKKKSELEKRKSE------LEKEKSELQKELLQLKDKVTKCEVTPAPRTTPAPTTSPCPQNWKH 192

  Fly   245 LGEKRYYLGIFFKANWFKATQYCRYHGMHLASISSQEEN----DRLEKHIRD---FGLGHEH--- 299
            .....|::.:..: :|..:..||:.:|.|||.|.:.||.    |.|.:...:   ||:..|.   
Zfish   193 FNGSCYFISVTTR-SWTDSQTYCKRYGGHLAIILTAEEQTFIWDLLPRGYWNAFWFGISDEKVED 256

  Fly   300 --FWISGTDLADEGNFFWMATGRPITFTNWNAGEPNNFRYENGEEENCLELWNRD---GKGLK-W 358
              .|:.||.|.  |.|             |..|||||.     .:|:|..:...|   ...:| |
Zfish   257 DWHWVDGTKLV--GGF-------------WEDGEPNNH-----IDEDCGYMIKTDVLTRVAIKSW 301

  Fly   359 NDSPCSFETYFVCE 372
            .|:||.....::||
Zfish   302 YDAPCHMSLPWICE 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tfcNP_612091.1 CLECT 249..373 CDD:153057 38/140 (27%)
zgc:174904NP_001170922.1 CLECT_DC-SIGN_like 186..316 CDD:153060 38/151 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.