DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tfc and si:ch73-86n18.1

DIOPT Version :9

Sequence 1:NP_612091.1 Gene:tfc / 38141 FlyBaseID:FBgn0035199 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001038504.2 Gene:si:ch73-86n18.1 / 564061 ZFINID:ZDB-GENE-141216-19 Length:263 Species:Danio rerio


Alignment Length:154 Identity:49/154 - (31%)
Similarity:67/154 - (43%) Gaps:11/154 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   224 CPNCVDESQYTPNKWTMPLLKLGEKRYYLGIFFKANWFKATQYCRYHGMHLASISSQEENDRLEK 288
            |...|.:.:..|..|    :.|.||.||.. ..|.:|..:.:.|...|.||..:.|.|::..||.
Zfish   114 CSKSVIKCRPCPEDW----MHLSEKCYYFS-DDKLDWQHSKESCASMGGHLTILHSHEQHHTLEA 173

  Fly   289 HIRDFGLGHEHFWISGTDLADEGNFFWMATGRPITFTNWN--AGEPNNFRYENGEEENCLELWNR 351
            ..|:.|....||||..:|...||.:.|: ....:..|.||  ..||||.|......|:|..|   
Zfish   174 VARNHGGMDYHFWIGLSDTETEGVWKWV-DNTVVNKTYWNEWEKEPNNHRSGGVHGEDCAVL--- 234

  Fly   352 DGKGLKWNDSPCSFETYFVCEVQP 375
            |.:...|.|.||.|....:||:.|
Zfish   235 DSRSKTWFDVPCDFHYKRICEMDP 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tfcNP_612091.1 CLECT 249..373 CDD:153057 40/125 (32%)
si:ch73-86n18.1NP_001038504.2 CLECT_DC-SIGN_like 124..256 CDD:153060 45/140 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 61 1.000 Inparanoid score I5392
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.070

Return to query results.
Submit another query.