DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tfc and zgc:194252

DIOPT Version :9

Sequence 1:NP_612091.1 Gene:tfc / 38141 FlyBaseID:FBgn0035199 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001122180.1 Gene:zgc:194252 / 561367 ZFINID:ZDB-GENE-081022-86 Length:251 Species:Danio rerio


Alignment Length:152 Identity:36/152 - (23%)
Similarity:61/152 - (40%) Gaps:33/152 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   236 NKWTMPLLKLG---EKRYYLGIFF-------KANWFKATQYCRYHGMHLASISSQEENDRLEKHI 290
            ||.|.....:|   :..:|....|       ::.|.:|..||..|.:.||.|.|::.  .:|..|
Zfish   110 NKNTFKASNIGCNDQLHFYCMFVFELIVIHQESTWEEALLYCPQHYLGLAIIDSKDM--MVEAKI 172

  Fly   291 RDFGLGHEHFWISGTDLADEGNFFWMATGRPITFTNWNAGEPNNFRYENGE------EENCLELW 349
            .......:..||....||  |::||: .|:.:.:..|::         |||      .:.| .::
Zfish   173 NSTEADTDDLWIGLRFLA--GSWFWV-NGKGVDYKAWSS---------NGELQCPAMNQRC-GVY 224

  Fly   350 NRDGKGLKWNDSPCSFETYFVC 371
            ||..:  .|..:.|.....|:|
Zfish   225 NRAKE--VWTPTDCVRRLNFLC 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tfcNP_612091.1 CLECT 249..373 CDD:153057 32/136 (24%)
zgc:194252NP_001122180.1 CLECT 22..131 CDD:295302 5/20 (25%)
CLECT 128..244 CDD:214480 31/132 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X29
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.