DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tfc and illr4

DIOPT Version :9

Sequence 1:NP_612091.1 Gene:tfc / 38141 FlyBaseID:FBgn0035199 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001035129.1 Gene:illr4 / 559737 ZFINID:ZDB-GENE-050311-5 Length:259 Species:Danio rerio


Alignment Length:267 Identity:60/267 - (22%)
Similarity:106/267 - (39%) Gaps:76/267 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 LREEQEEEEEADDQER-DQQPLAN-----------------------------QEDFDYDVQESL 195
            ::::|.::::.||.:: |.|...:                             |...:::.|:.|
Zfish    13 VKKKQADKDDEDDPDQCDLQKRRSCCDGVRLVLTALCVIFTTGLIALSFLCYMQATSNHNFQKKL 77

  Fly   196 QSVESEQHDQYYGN----------IFHRDPSENEVDNDCPNCVDESQYTPNKWTMPLLKLGEKRY 250
            |.:: |.||....|          |::|:.:.:...|:...|.::.||...|.           |
Zfish    78 QDLQ-EVHDALQENFTAFSAVLEHIYNREQNLSRALNNSAQCPEDWQYHAGKC-----------Y 130

  Fly   251 YLGIFFKAN-----WFKATQYCRYHGMHLASISSQEENDRLEKHIRDFGLGHEHFWISGTDLADE 310
            |    |.:|     |||:...|...|.||..|::::|.:.|......:   ...|||..||.:.|
Zfish   131 Y----FSSNTNTLDWFKSRDACISDGGHLVIINNRDEQEFLMSKTNKY---KGSFWIGLTDKSTE 188

  Fly   311 GNFFWMATGRPIT-FTNWNAGEPNN---FRYENGEEENCLEL----WNRDGKGLKWNDSPCSFET 367
            |.:.|:...:..| ...||..||:|   :|.|..|.|:|..:    ||.:    .|.|:.|:...
Zfish   189 GQWLWVDNTKLSTDIRYWNGQEPDNWKGYRNEYTEGEDCARIEQNNWNIN----SWFDAFCTIAF 249

  Fly   368 YFVCEVQ 374
            ..:||.:
Zfish   250 RRICETR 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tfcNP_612091.1 CLECT 249..373 CDD:153057 39/136 (29%)
illr4NP_001035129.1 CLECT_DC-SIGN_like 118..255 CDD:153060 43/158 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 61 1.000 Inparanoid score I5392
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm25696
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
55.070

Return to query results.
Submit another query.