DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tfc and acanb

DIOPT Version :9

Sequence 1:NP_612091.1 Gene:tfc / 38141 FlyBaseID:FBgn0035199 Length:376 Species:Drosophila melanogaster
Sequence 2:XP_021326217.1 Gene:acanb / 559593 ZFINID:ZDB-GENE-100422-16 Length:1376 Species:Danio rerio


Alignment Length:411 Identity:90/411 - (21%)
Similarity:152/411 - (36%) Gaps:106/411 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SLASVDSGHNSPVTTIPVAEPISQVPHGFQLGQNNHI---SSSSNISRSGGGNGRDKRGAQLDPS 73
            |.:...||..|.:.:.|.:...|....||  |.::.|   |||:::.:|....|..  |....||
Zfish   936 SASGFGSGIASGIESSPASAFGSSSASGF--GSSSAIGLESSSASVFKSVSVTGTS--GYPNHPS 996

  Fly    74 EIARQNQITQQIFANYLERRLFPNRTANQKIPTIADILPKPKPSPRPRPRGFAASDGGNFKRSGG 138
                 .::::.|.....|..:|.:....:.  |:             ||........|:.:.||.
Zfish   997 -----GEVSENIQRQDGEMIIFTDDEVTEL--TL-------------RPTAGTEQGRGSVEISGE 1041

  Fly   139 GAQRNRLAAAASKRQSGYNRKRLREEQEEEEEADD--QERDQQPLANQEDFDYDVQE-------- 193
            |:           ....|....:........|::|  .|||::.....|.||...:.        
Zfish  1042 GS-----------TPEPYTEDSISVSNSTSHESNDLLPERDEKISVTMEAFDVTDKSPLITTPTN 1095

  Fly   194 ----------SLQSVESEQHDQYYGNIFHRDPSENEVDND-C-PN---------------CVDES 231
                      |||..:|..           :||.||..:| | ||               |...|
Zfish  1096 IPVLTTPSSASLQMPKSTM-----------NPSVNEAPSDPCDPNPCGQGLCSLQDGVALCQCHS 1149

  Fly   232 QYTPNKWTMPLLKLGE------KRYYLGIFFKANWFKATQYCRYHGMHLASISSQEENDRLEKHI 290
            .::....::.:....|      ...|:....:..|..|.|:|:....||.|||||:|.:.::...
Zfish  1150 GFSGENCSVLVQGCAEGWMEFMGSCYIHFDERETWTSAEQHCQELNSHLVSISSQQEQEFVKTQA 1214

  Fly   291 RDFGLGHEHFWISGTDLADEGNFFWMATGRPITFTNWNAGEPNNFRYENGEEENC-LELWNRDGK 354
            :|:.      ||...|...:..|.| ..|.|:.:.||...:|:|: :..||:  | :.:|:.:| 
Zfish  1215 QDYQ------WIGLNDKDVQNEFRW-TDGSPLEYENWRPNQPDNY-FSTGED--CVVMIWHENG- 1268

  Fly   355 GLKWNDSPCSFETYFVCEVQP 375
              :|||.||::...|.|:.:|
Zfish  1269 --QWNDVPCNYHLPFTCKSEP 1287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tfcNP_612091.1 CLECT 249..373 CDD:153057 37/124 (30%)
acanbXP_021326217.1 Ig 45..159 CDD:325142
Link_domain_CSPGs_modules_1_3 158..252 CDD:239594
Link_domain_CSPGs_modules_2_4 260..354 CDD:239597
Xlink 459..553 CDD:306661
Link_domain_CSPGs_modules_2_4 560..655 CDD:239597
CLECT 1163..1284 CDD:321932 37/133 (28%)
CCP 1290..1347 CDD:153056
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 77 1.000 Domainoid score I8750
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4956
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.