DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tfc and si:dkey-88n24.6

DIOPT Version :9

Sequence 1:NP_612091.1 Gene:tfc / 38141 FlyBaseID:FBgn0035199 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001314972.1 Gene:si:dkey-88n24.6 / 555551 ZFINID:ZDB-GENE-041014-88 Length:368 Species:Danio rerio


Alignment Length:134 Identity:41/134 - (30%)
Similarity:57/134 - (42%) Gaps:21/134 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   253 GIFF---KANWFKATQYCRYHGMHLASISSQEENDRLEKHIRDFGLGHEHFWISGTDLADEGNFF 314
            |:.|   ...|.:|..|||.:.:.|.|:.:|.||.:|||.|.|........||.    .....:.
Zfish   135 GLVFVNQSMTWREAQSYCRQNHIDLVSVRNQNENQQLEKFINDRNSSGSAVWIG----LFRDTWQ 195

  Fly   315 WMATGRPITFTNWNAGEPNNFRYENGEEENCLELWNRDGKGLKWNDSPC-SFETYFVCE------ 372
            |:..... :|..|..|||||:    |..|:|..:.....:|  |.|.|| |.:..|||.      
Zfish   196 WLDQSNS-SFRYWYPGEPNNY----GGHEDCAVIGKNTQRG--WADVPCDSRQIPFVCHEDKLIV 253

  Fly   373 VQPN 376
            :|.|
Zfish   254 IQQN 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tfcNP_612091.1 CLECT 249..373 CDD:153057 39/129 (30%)
si:dkey-88n24.6NP_001314972.1 CLECT_1 23..129 CDD:153072
CLECT_1 136..247 CDD:153072 37/121 (31%)
CLECT 253..365 CDD:153057 2/5 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X29
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.