DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tfc and si:dkey-88n24.10

DIOPT Version :9

Sequence 1:NP_612091.1 Gene:tfc / 38141 FlyBaseID:FBgn0035199 Length:376 Species:Drosophila melanogaster
Sequence 2:XP_021333312.1 Gene:si:dkey-88n24.10 / 555408 ZFINID:ZDB-GENE-070424-265 Length:384 Species:Danio rerio


Alignment Length:146 Identity:40/146 - (27%)
Similarity:66/146 - (45%) Gaps:28/146 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   240 MPLLKLG-------EKRYYLGIFFKANWFKATQYCRYHGMHLASISS------QEENDRLEKHIR 291
            :|||.:.       .:|.|..|..|.||.:|.:|||.....||::.:      .|:|..:.:.|:
Zfish     7 VPLLLIALCSISECVQRQYHFIKEKKNWTEAQRYCREKYTDLATVDNTNYMIKSEKNVLVWQRIK 71

  Fly   292 DFGLG-HEHFWISGTDLADEGNFFWMATGRPITFTNWNAGEPNNFRYENGEEENCLELWNRDGKG 355
            .|... .:..|| |........:.| ::|.|:.|.||.:|:|.|       .:||..:  |:|:.
Zfish    72 SFNYRFRQKIWI-GLQRMSVYKWHW-SSGDPVLFLNWASGQPVN-------SDNCAVV--RNGQW 125

  Fly   356 LKWNDSPCSFETYFVC 371
            ..|   ||:..:.|:|
Zfish   126 TVW---PCNAISSFIC 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tfcNP_612091.1 CLECT 249..373 CDD:153057 37/130 (28%)
si:dkey-88n24.10XP_021333312.1 CLECT 23..139 CDD:321932 37/130 (28%)
CLECT_1 144..254 CDD:153072
CLECT 269..381 CDD:153057
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X29
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.