DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tfc and lectin-21Ca

DIOPT Version :9

Sequence 1:NP_612091.1 Gene:tfc / 38141 FlyBaseID:FBgn0035199 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_652642.2 Gene:lectin-21Ca / 53552 FlyBaseID:FBgn0040107 Length:269 Species:Drosophila melanogaster


Alignment Length:238 Identity:58/238 - (24%)
Similarity:104/238 - (43%) Gaps:34/238 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 AASKRQSGYNRKRLREEQEEEEEADDQ--------ERDQQPLANQEDFDYDVQESLQSVESE-QH 203
            :|::.|....||:|.:.:.:|:|.:|:        :.:...|:.:.....::|..|.|:|.: |.
  Fly    57 SANEVQVNETRKQLAKIEGQEKETNDKIKVIHDNVDNEFNALSAKIKNVKNIQRHLASLELQLQE 121

  Fly   204 DQYYGNIFHRDPSENEVDNDCPNCVDESQYTPNKWTMPLLKLGEKRYYLGIFFKANWFKATQYCR 268
            .:...|:      ..|.....|.....||:.         |:|.:.:::....|.:|||||..|.
  Fly   122 TKKALNL------SVEAKKVMPKTEIPSQFQ---------KIGWRHFFIEKKHKVDWFKATSMCH 171

  Fly   269 YHGMHLASISSQEENDRLEKHIRDFGLGHEHFWISGTDLADEGNFFWMATGRPITFTNWNAGEPN 333
            ..|.||.:|.|::|.|.:...::|...|...||:...|:|..|.|..:|||....|..|:...| 
  Fly   172 KMGAHLLTIQSEDELDAIRTELKDINDGSHDFWLDINDIAKWGEFISLATGMNPPFLKWHKHRP- 235

  Fly   334 NFRYENGEEENCLELWNRDGKGLKWNDSPCSFETYFVCEVQPN 376
                :....:.|:.|     :|.:..|..||.:..|:|::..|
  Fly   236 ----QVQIHQRCVHL-----RGGEMMDGKCSEQFLFICQLAVN 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tfcNP_612091.1 CLECT 249..373 CDD:153057 36/123 (29%)
lectin-21CaNP_652642.2 CLECT 158..265 CDD:153057 35/116 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22802
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4956
SonicParanoid 1 1.000 - - X29
44.040

Return to query results.
Submit another query.