DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tfc and lectin-24Db

DIOPT Version :9

Sequence 1:NP_612091.1 Gene:tfc / 38141 FlyBaseID:FBgn0035199 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_652641.1 Gene:lectin-24Db / 53550 FlyBaseID:FBgn0040102 Length:359 Species:Drosophila melanogaster


Alignment Length:229 Identity:63/229 - (27%)
Similarity:100/229 - (43%) Gaps:46/229 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 REEQEEEEEADD------------QERDQQPLANQ------EDFDYDVQESLQSVESEQHDQYYG 208
            :|.|:::.||..            |..:||.|..:      |||    :..||.:|..|.|:.  
  Fly   154 KESQQDQLEALKNAMPINFEMRLAQIEEQQKLLQETLKKIPEDF----ERKLQKLEQNQKDEL-- 212

  Fly   209 NIFHRDPSENEVDNDCPNCVDESQYTPNKWTMPLLKLGEKRYYLGIFFKANWFKATQYCRYHGMH 273
            .......|.|:|       ..:..||...|. ...::|.:.:|:......:|..|..:||..|.:
  Fly   213 TKLGAQQSANQV-------TLKEIYTKVFWP-KFERIGSRLFYINHKDAYDWQSAVDFCRDMGGY 269

  Fly   274 LASISSQEENDRLEKHIRDFGLGHEHFWISGTDLADEGNFFWMATGRPITFTNWNAGEPNNFRYE 338
            :|:|..|||.|.:...:.|     :.:|:...||.....:..:|:||.:.|.||||||||:    
  Fly   270 IAAIKDQEELDAISARLDD-----KSYWLGINDLQSSNTYVSVASGREVEFLNWNAGEPNH---- 325

  Fly   339 NGEEENCLELWNRDGKGLKWNDSPCSFETYFVCE 372
            ..|:|||:||...     |.||.||..:.:.:|:
  Fly   326 GNEDENCVELIRS-----KMNDDPCHRKKHVICQ 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tfcNP_612091.1 CLECT 249..373 CDD:153057 40/124 (32%)
lectin-24DbNP_652641.1 ExsD <44..>156 CDD:293411 0/1 (0%)
NAT_SF <170..>229 CDD:302625 15/71 (21%)
CLECT 247..354 CDD:153057 39/120 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.