DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tfc and CLEC4A

DIOPT Version :9

Sequence 1:NP_612091.1 Gene:tfc / 38141 FlyBaseID:FBgn0035199 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_057268.1 Gene:CLEC4A / 50856 HGNCID:13257 Length:237 Species:Homo sapiens


Alignment Length:163 Identity:37/163 - (22%)
Similarity:64/163 - (39%) Gaps:45/163 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   228 VDESQYT--PNKWTMPLLKLGEKRYYLGIFF----KANWFKATQYCRYHGMHLASISSQEENDRL 286
            |:|:.::  |..|         |.:....:|    .|:|..:.:.|.....||..|::|||.|.:
Human    98 VEETAWSCCPKNW---------KSFSSNCYFISTESASWQDSEKDCARMEAHLLVINTQEEQDFI 153

  Fly   287 EKHIRD-----FGL----GHEHF-WISGTDLADEGNFFWMATGRPITFTNWNAGEPNNFRYENGE 341
            .:::::     .||    |..|: |:..|...:...|             |:..||::      .
Human   154 FQNLQEESAYFVGLSDPEGQRHWQWVDQTPYNESSTF-------------WHPREPSD------P 199

  Fly   342 EENCLEL-WNRDGKGLKWNDSPCSFETYFVCEV 373
            .|.|:.| :.:..|...|||..|......|||:
Human   200 NERCVVLNFRKSPKRWGWNDVNCLGPQRSVCEM 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tfcNP_612091.1 CLECT 249..373 CDD:153057 31/138 (22%)
CLEC4ANP_057268.1 ITIM motif. /evidence=ECO:0000269|PubMed:20530286 5..10
CLECT_DC-SIGN_like 106..232 CDD:153060 34/153 (22%)
Mannose binding. /evidence=ECO:0000269|PubMed:27015765, ECO:0007744|PDB:5B1X 195..197 1/1 (100%)
N-acetyl-D-glucosamine binding. /evidence=ECO:0000269|PubMed:27015765, ECO:0007744|PDB:5B1X 207..209 0/1 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165150874
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BFQ9
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.