DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tfc and Cd209e

DIOPT Version :9

Sequence 1:NP_612091.1 Gene:tfc / 38141 FlyBaseID:FBgn0035199 Length:376 Species:Drosophila melanogaster
Sequence 2:XP_006248837.1 Gene:Cd209e / 501797 RGDID:1563333 Length:215 Species:Rattus norvegicus


Alignment Length:193 Identity:49/193 - (25%)
Similarity:82/193 - (42%) Gaps:52/193 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   195 LQSVESEQHDQYYGNIFHRDPSE--NEVDNDCPNCVDESQYTPNKWTMPLLKLGEKRYYLGIFFK 257
            :.|.|..|.:|......::|.|:  :|:|:.|..|       |..||               ||.
  Rat    51 IPSSEEVQWEQTKQEKMYQDLSQLKSEIDSLCRLC-------PWDWT---------------FFN 93

  Fly   258 AN----------WFKATQYCRYHGMHLASISSQEENDRLEKHIRDFGLGHEHFWISGTDLADEGN 312
            .|          |..:...|:.....|.:|.|.||...|::..:..|    :.|:..:||..||.
  Rat    94 GNCYFFSKSQRDWHNSITACQEMEAQLVTIKSPEEQSFLQQTSKKNG----YTWMGLSDLNKEGE 154

  Fly   313 FFWMATGRPITFT---NWNAGEPNNFRYENGEEENCLELWNRDGKGLKWNDSPCSFETYFVCE 372
            ::|: .|.|::.:   .||.|:|||.     :.::|:|..| ||    |||:.|....:::|:
  Rat   155 WYWL-DGSPLSDSLRNYWNEGQPNNI-----DGQDCVEFRN-DG----WNDAKCDNWKFWICK 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tfcNP_612091.1 CLECT 249..373 CDD:153057 36/137 (26%)
Cd209eXP_006248837.1 CLECT_DC-SIGN_like 85..207 CDD:153060 40/159 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344402
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BFQ9
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.