DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tfc and OLR1

DIOPT Version :9

Sequence 1:NP_612091.1 Gene:tfc / 38141 FlyBaseID:FBgn0035199 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_002534.1 Gene:OLR1 / 4973 HGNCID:8133 Length:273 Species:Homo sapiens


Alignment Length:260 Identity:51/260 - (19%)
Similarity:94/260 - (36%) Gaps:69/260 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 GAQRNRLAAAASKRQSG--YNRKRLREE----QEEEEEADDQERDQQPLANQEDFDYDVQESLQS 197
            |.|.::::...::.|:.  :.:|:|..:    |:.||.:.:.|.:.:.:..      .:...|..
Human    57 GMQLSQVSDLLTQEQANLTHQKKKLEGQISARQQAEEASQESENELKEMIE------TLARKLNE 115

  Fly   198 VESEQHDQYYGNIFHRDPSENEVDNDCPNCVDESQYTPNKWTMPLLKLGEKRYYL--GIFFKANW 260
            ...||.:     :.|::.:..|......||   |...|..|    :..||..|..  |.|   ||
Human   116 KSKEQME-----LHHQNLNLQETLKRVANC---SAPCPQDW----IWHGENCYLFSSGSF---NW 165

  Fly   261 FKATQYCRYHGMHLASISSQEENDRLEKHIRDFGLGHEHFWISGTDLADEGNF-FWMATGR--PI 322
            .|:.:.|......|..|:|..:.|.:::.|                  ...:| |||...|  |.
Human   166 EKSQEKCLSLDAKLLKINSTADLDFIQQAI------------------SYSSFPFWMGLSRRNPS 212

  Fly   323 TFTNWNAGE---PNNFR--------YENGEEENCLELWNRDGKGLKWNDSPCSFETYFVCEVQPN 376
            ....|..|.   |:.||        |.:|   .|..:    .:|..:.:: |....:.:|:.:.|
Human   213 YPWLWEDGSPLMPHLFRVRGAVSQTYPSG---TCAYI----QRGAVYAEN-CILAAFSICQKKAN 269

  Fly   377  376
            Human   270  269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tfcNP_612091.1 CLECT 249..373 CDD:153057 29/139 (21%)
OLR1NP_002534.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22
Neck 58..150 18/109 (17%)
SMC_N <73..>137 CDD:330553 11/74 (15%)
CLECT_NK_receptors_like 144..266 CDD:153063 33/154 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.