DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tfc and Ly49si1

DIOPT Version :9

Sequence 1:NP_612091.1 Gene:tfc / 38141 FlyBaseID:FBgn0035199 Length:376 Species:Drosophila melanogaster
Sequence 2:XP_038963952.1 Gene:Ly49si1 / 494206 RGDID:1359487 Length:476 Species:Rattus norvegicus


Alignment Length:173 Identity:34/173 - (19%)
Similarity:55/173 - (31%) Gaps:51/173 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   195 LQSVESEQHDQYYGNIFHRDPSENEVDNDCPNCVDESQYTPNKWTMPLLKLGEKRYYLGIFFKAN 259
            |||:..||...|               ::....:..||:|.....:.....|.|.||. |..|..
  Rat   325 LQSLNREQTRWY---------------SETKTVIPSSQHTGKNVEIYWFCYGIKCYYF-ILDKKT 373

  Fly   260 WFKATQYCRYHGMHLASISSQEENDRLEKHIRDFGLGHEHFWISGTDLADEGNFFWMATGRPITF 324
            |....|.|:...:.|..|..::|...|...:..     :.:||..:....:..:.|:        
  Rat   374 WIGCQQACQKSRLSLLKIDYEDELMFLRLQVLS-----DQYWIGLSYNKAKEEWSWI-------- 425

  Fly   325 TNWNAGEPNNFRYENGEEENCLELWNRDGKGLKWND--SPCSF 365
                         :||:.|..|.|       .|:|:  ..|.|
  Rat   426 -------------DNGQSEFSLNL-------KKYNEKYGGCMF 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tfcNP_612091.1 CLECT 249..373 CDD:153057 23/119 (19%)
Ly49si1XP_038963952.1 Ly49 40..158 CDD:400616
CLECT 146..>193 CDD:413318
Ly49 248..367 CDD:400616 12/56 (21%)
CLECT_NK_receptors_like 354..469 CDD:153063 25/129 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X29
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.