DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tfc and colec11

DIOPT Version :9

Sequence 1:NP_612091.1 Gene:tfc / 38141 FlyBaseID:FBgn0035199 Length:376 Species:Drosophila melanogaster
Sequence 2:XP_009291466.1 Gene:colec11 / 492459 ZFINID:ZDB-GENE-041114-11 Length:277 Species:Danio rerio


Alignment Length:158 Identity:44/158 - (27%)
Similarity:73/158 - (46%) Gaps:14/158 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   219 EVDNDCPNCVDESQYTPNKWTMPL----LKLGEKRYYLGIFFKANWFKATQYCRYHGMHLASISS 279
            |:|.......:|.::..|....|.    :|..:.:.||.:..:..:.:|..:|:..|.|||....
Zfish   124 EMDIQVVQLTNELKFIKNALPSPAAVAGIKETDSKVYLLVKEEKRYREAEVFCQGRGGHLAMPKD 188

  Fly   280 QEENDRLEKHIRDFGLGHEHFWISGTDLADEGNFFWMATGRPITFTNWNAGEPNNFRYENGEEEN 344
            ...|..:..::.|.||...:..|:  ||..||:|.::......||:.|..||||| .|   ::|:
Zfish   189 AAANRAIAGYVTDAGLSRVYIGIN--DLEREGHFVYVERSPMTTFSRWREGEPNN-AY---DDED 247

  Fly   345 CLELWNRDGKGLKWNDSPCSFETYFVCE 372
            |:|:.:..    :|.|..|....|||||
Zfish   248 CVEMVSSG----EWIDVACQLTMYFVCE 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tfcNP_612091.1 CLECT 249..373 CDD:153057 38/124 (31%)
colec11XP_009291466.1 Collagen 44..102 CDD:189968
CLECT_collectin_like 157..272 CDD:153061 38/125 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4956
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.