DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tfc and Clec4a4

DIOPT Version :9

Sequence 1:NP_612091.1 Gene:tfc / 38141 FlyBaseID:FBgn0035199 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001005860.1 Gene:Clec4a4 / 474145 MGIID:3624119 Length:236 Species:Mus musculus


Alignment Length:165 Identity:43/165 - (26%)
Similarity:64/165 - (38%) Gaps:39/165 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   226 NCVDESQYTPNK-WT------MPLLKLGEKRYYLGIFFKANWFKATQYCRYHGMHLASISSQEEN 283
            ||:.......:| |:      .|.:   ...|::....||:|.::.:.|.:.|.||..|.||.|.
Mouse    91 NCIKNGSLMEDKVWSCCPKDWKPFV---SHCYFILNDSKASWNESEEKCSHMGAHLVVIHSQAEQ 152

  Fly   284 DRLEKHIRD-----FGL---GHEHF-WISGTDLADEGNFFWMATGRPITFTNWNAGEPNNFRYEN 339
            |.:..::..     .||   |...: ||..|.......|             |:.||||.     
Mouse   153 DFITSNLNTSAGYFIGLLDAGQRQWRWIDQTPYNKSATF-------------WHKGEPNQ----- 199

  Fly   340 GEEENCLELWNRDGKGLKWNDSPCSFETYFVCEVQ 374
             :.|.|: :.|....|..|||.||..|...||:|:
Mouse   200 -DWERCV-IINHKTTGWGWNDIPCKDEHNSVCQVK 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tfcNP_612091.1 CLECT 249..373 CDD:153057 37/132 (28%)
Clec4a4NP_001005860.1 CLECT_DC-SIGN_like 107..230 CDD:153060 37/145 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167840882
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BFQ9
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.