DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tfc and Clec4e

DIOPT Version :9

Sequence 1:NP_612091.1 Gene:tfc / 38141 FlyBaseID:FBgn0035199 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001005897.2 Gene:Clec4e / 450223 RGDID:1359298 Length:215 Species:Rattus norvegicus


Alignment Length:166 Identity:42/166 - (25%)
Similarity:61/166 - (36%) Gaps:40/166 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   219 EVDNDCPNCVDESQYTPNKWTMPLLKLGEKRYYLGIFF----KANWFKATQYCRYHGMHLASISS 279
            |......||      .|..|         |.:....:|    ...|..:...|...|.||..|::
  Rat    72 EASGSVKNC------CPLNW---------KHFQSSCYFFSTTTLTWPSSLNNCSDMGAHLVVINT 121

  Fly   280 QEENDRL-----EKHIRDFGLGHEHFWISGTDLADEGNFFWMATGRPIT--FTNWNAGEPNNFRY 337
            .||.:.|     .|         :.|:|..||...||.:.|: ...|.|  .:.|:||||||..:
  Rat   122 WEEQEFLFRTKPRK---------KEFYIGLTDQVVEGQWRWV-DDTPFTESLSFWDAGEPNNIVF 176

  Fly   338 ENGEEENCLELWNRDGKGLKWNDSPCSFETYFVCEV 373
                .|:|..:.:.......|||..|.|...::||:
  Rat   177 ----VEDCATMRDSSNPRKNWNDVSCFFSMPWICEM 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tfcNP_612091.1 CLECT 249..373 CDD:153057 35/134 (26%)
Clec4eNP_001005897.2 CLECT_DC-SIGN_like 81..208 CDD:153060 38/149 (26%)
Confers specificity for glucose/mannose-type carbohydrates. /evidence=ECO:0000250|UniProtKB:Q9ULY5 170..172 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344409
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.