DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tfc and Clec4b2

DIOPT Version :9

Sequence 1:NP_612091.1 Gene:tfc / 38141 FlyBaseID:FBgn0035199 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001005896.2 Gene:Clec4b2 / 450222 RGDID:1359354 Length:208 Species:Rattus norvegicus


Alignment Length:145 Identity:43/145 - (29%)
Similarity:61/145 - (42%) Gaps:25/145 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   235 PNKWTMPLLKLGEKRYYLGIFFKANWFKATQYCRYHGMHLASISSQEENDRLEKHIRDFGLGHEH 299
            |..|     |......|....|.|||.::.:.|.:.|.||..|.||||.|.:...:       :.
  Rat    80 PKDW-----KSFGSHCYFTTDFVANWNESKEKCSHMGAHLLVIHSQEEQDFINGIL-------DT 132

  Fly   300 FWISGTDLADEGNFFWM-----ATGRPITFTNWNAGEPNNFRYENGEEENCLELWNRDGKGLKWN 359
            .|...|.|:|:|...|.     .....:||  |:..||||      :.|.|:|:.:....|..||
  Rat   133 RWGYFTGLSDQGQNQWQWIDQTPYNESVTF--WHEDEPNN------DYEKCVEINHHKDIGWGWN 189

  Fly   360 DSPCSFETYFVCEVQ 374
            |..||.|...:|:|:
  Rat   190 DIVCSSEHKSICQVK 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tfcNP_612091.1 CLECT 249..373 CDD:153057 39/128 (30%)
Clec4b2NP_001005896.2 CLECT_DC-SIGN_like 79..202 CDD:153060 41/141 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344290
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BFQ9
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.