DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tfc and ASGR2

DIOPT Version :9

Sequence 1:NP_612091.1 Gene:tfc / 38141 FlyBaseID:FBgn0035199 Length:376 Species:Drosophila melanogaster
Sequence 2:XP_011522164.2 Gene:ASGR2 / 433 HGNCID:743 Length:410 Species:Homo sapiens


Alignment Length:367 Identity:84/367 - (22%)
Similarity:141/367 - (38%) Gaps:116/367 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 PVAEPISQVPHG---FQLGQNNHISSSSNI----------SRSGGGNGRD--KRGAQLDPSEIAR 77
            |.|:|::|....   |.|     ::.|.||          |:|.|..|:.  .|||||. :|:  
Human   136 PPAQPLAQRLCSMVCFSL-----LALSFNILLLVVICVTGSQSEGHGGQQGWARGAQLQ-AEL-- 192

  Fly    78 QNQITQQIFANYLERRLFPNRTANQKIPTIADILPKPKPSPRPRPRGFAASDGGNFKRSGGGAQR 142
              :..::.|:|:....|    |..|.|.|                              .||:..
Human   193 --RSLKEAFSNFSSSTL----TEVQAIST------------------------------HGGSVG 221

  Fly   143 NRLAAAASKRQSGYNRKRLREEQEEEEEADDQERDQQPLANQEDFDYDVQESLQSVESEQHDQYY 207
            :::.:..:|          .|:|:::.:||....    |.:.:.|..|::.....:|        
Human   222 DKITSLGAK----------LEKQQQDLKADHDAL----LFHLKHFPVDLRFVACQME-------- 264

  Fly   208 GNIFHRDPSENEVDNDCP-NCVDESQYTPNKWTMPLLKLGEKRYYLGIFFKANWFKATQYCRYHG 271
              :.|.:.|:...   || |.|:..               ...|:.....|| |.:|.:||:...
Human   265 --LLHSNGSQRTC---CPVNWVEHQ---------------GSCYWFSHSGKA-WAEAEKYCQLEN 308

  Fly   272 MHLASISSQEENDRLEKHIRDFGLGHEHFWISGTDLADEGNFFWM-ATGRPITFTNWNAGEPNNF 335
            .||..|:|.||...:.:|...|     :.||..||  .:|::.|: .|.....:.||...:|:|:
Human   309 AHLVVINSWEEQKFIVQHTNPF-----NTWIGLTD--SDGSWKWVDGTDYRHNYKNWAVTQPDNW 366

  Fly   336 R-YENGEEENCLELWNRDGKGLKWNDSPCSFETYFVCEVQPN 376
            . :|.|..|:|:|: ..||   :|||..|.....:|||.:.|
Human   367 HGHELGGSEDCVEV-QPDG---RWNDDFCLQVYRWVCEKRRN 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tfcNP_612091.1 CLECT 249..373 CDD:153057 39/125 (31%)
ASGR2XP_011522164.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165150880
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.