DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tfc and ASGR1

DIOPT Version :9

Sequence 1:NP_612091.1 Gene:tfc / 38141 FlyBaseID:FBgn0035199 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001662.1 Gene:ASGR1 / 432 HGNCID:742 Length:291 Species:Homo sapiens


Alignment Length:315 Identity:70/315 - (22%)
Similarity:106/315 - (33%) Gaps:108/315 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 IARQNQITQQIFANYLERRLFPNRTANQKIPTIADILPKPKPSPRPRPRGFAASDGGNFKRSGGG 139
            |..||...|:.....  |..|.|.||                |...:.:|. ::.|||..|    
Human    59 IGSQNSQLQEELRGL--RETFSNFTA----------------STEAQVKGL-STQGGNVGR---- 100

  Fly   140 AQRNRLAAAASKRQSGYNRKRLREEQEEEEEADDQERDQQPLANQEDFDYDVQE------SLQSV 198
                              :.:..|.|.|:::.|..|.....|.:.:.|..|::.      :||..
Human   101 ------------------KMKSLESQLEKQQKDLSEDHSSLLLHVKQFVSDLRSLSCQMAALQGN 147

  Fly   199 ESEQHDQYYGNIFHRDPSENEVDNDCP-NCVDESQYTPNKWTMPLLKLGEKRYYLGIFFKANWFK 262
            .||:                   ..|| |.|:..:               ..|:.....|| |..
Human   148 GSER-------------------TCCPVNWVEHER---------------SCYWFSRSGKA-WAD 177

  Fly   263 ATQYCRYHGMHLASISSQEENDRLEKHIRD----FGLGHEH---FWISGTDLADEGNFFWMATGR 320
            |..|||....||..::|.||...::.||..    .||..::   .|:.|||         ..|| 
Human   178 ADNYCRLEDAHLVVVTSWEEQKFVQHHIGPVNTWMGLHDQNGPWKWVDGTD---------YETG- 232

  Fly   321 PITFTNWNAGEPNN-FRYENGEEENCLELWNRDGKGLKWNDSPCSFETYFVCEVQ 374
               |.||...:|:: :.:..|..|:|.. :..||   :|||..|.....:|||.:
Human   233 ---FKNWRPEQPDDWYGHGLGGGEDCAH-FTDDG---RWNDDVCQRPYRWVCETE 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tfcNP_612091.1 CLECT 249..373 CDD:153057 38/131 (29%)
ASGR1NP_001662.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30
Endocytosis signal. /evidence=ECO:0000255 5..8
Lectin_N 17..144 CDD:309178 23/125 (18%)
CLECT_DC-SIGN_like 154..279 CDD:153060 42/157 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165150866
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.