DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tfc and clec-181

DIOPT Version :9

Sequence 1:NP_612091.1 Gene:tfc / 38141 FlyBaseID:FBgn0035199 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001033456.2 Gene:clec-181 / 3896812 WormBaseID:WBGene00044511 Length:194 Species:Caenorhabditis elegans


Alignment Length:168 Identity:34/168 - (20%)
Similarity:59/168 - (35%) Gaps:40/168 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   207 YGNIFHRDPSENEVDNDCPNCVDESQYTPNKWTMPL----LKLGEK------RYYLGIFFKANWF 261
            :||:.....:|.       .|.|:|.....|...|.    ||....      :.:.|...:|:..
 Worm    17 FGNLIFATSNEE-------TCEDDSNNGGGKVKKPCEPGWLKFNRPSGVWCIKVFNGTHSQADAE 74

  Fly   262 KATQYCRYHGMHLASISSQEENDRL-EKHIRDFGLGHEHFWISG--TDLADEG----------NF 313
            |..|  :.:|..|:.:.:|.|...: ::.:.....|....||..  |.|....          :|
 Worm    75 KLCQ--KNYGATLSGVQNQREISYVTQQALGTMSQGSGSIWIGAKRTTLCKASRLSKYCNTLTSF 137

  Fly   314 FW---MATGRPITFTNWNAGEPNNFRYENGEEENCLEL 348
            .|   .|:|  :....||..:|:| .|...::  |:.|
 Worm   138 QWTDGSASG--LDGLIWNNNQPDN-NYNRTDQ--CVVL 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tfcNP_612091.1 CLECT 249..373 CDD:153057 24/116 (21%)
clec-181NP_001033456.2 CLECT 45..170 CDD:214480 25/131 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X29
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.