DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tfc and CG34033

DIOPT Version :9

Sequence 1:NP_612091.1 Gene:tfc / 38141 FlyBaseID:FBgn0035199 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001033937.1 Gene:CG34033 / 3885602 FlyBaseID:FBgn0054033 Length:168 Species:Drosophila melanogaster


Alignment Length:147 Identity:32/147 - (21%)
Similarity:65/147 - (44%) Gaps:25/147 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   238 WTMPLLKLGEKR-YYLGIFFK---ANWFKATQYCRYHGMHLASISSQEENDRLEKHIRDFGLGHE 298
            |.:.||:..|.. ..:.::|.   |:||.|...|:...|.||.::::....:::..|...  .||
  Fly    14 WLLLLLRADEANGKGICLYFSEKTASWFSALTICKSLHMCLADLNTEVTLFQMKSKINQD--DHE 76

  Fly   299 HFWISGTDLADEGNFFWMATGRPITFTNWNAGEPNN------------FRYENGE-EEN----CL 346
             :|. |.:..|:..:.:::..:.|.::..|:...||            |::|:.: .|:    |.
  Fly    77 -YWF-GLNAHDKPTYRYVSNNKSIEYSPHNSKLVNNEGCVYVKQQNDFFKFESAKCREHRRFICT 139

  Fly   347 ELWNRDGKGLKWNDSPC 363
            :....||..:|..:|.|
  Fly   140 KTDECDGVSMKHGNSKC 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tfcNP_612091.1 CLECT 249..373 CDD:153057 28/136 (21%)
CG34033NP_001033937.1 CLECT 30..140 CDD:153057 23/113 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454804
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.