DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tfc and CLEC17A

DIOPT Version :10

Sequence 1:NP_612091.1 Gene:tfc / 38141 FlyBaseID:FBgn0035199 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001191047.1 Gene:CLEC17A / 388512 HGNCID:34520 Length:378 Species:Homo sapiens


Alignment Length:141 Identity:43/141 - (30%)
Similarity:64/141 - (45%) Gaps:25/141 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   235 PNKWTMPLLKLGEKRYYLGIFFKANWFKATQYCRYHGMHLASISSQEENDRLEKHIRDFGLGH-- 297
            |..|    |....|.||.....| :|.:|..:|:.:..||..|:|..|::.:.|       .|  
Human   255 PEGW----LPFEGKCYYFSPSTK-SWDEARMFCQENYSHLVIINSFAEHNFVAK-------AHGS 307

  Fly   298 -EHFWISGTDLADEGNFFWMATGRPITFTNWNAGEPNNFRYENGEEENCLELWNRDGKGLKWNDS 361
             ..:|:...|.|.||::.|: .|.|:|.:.|...||||.     .:|:|..:    .||..|||.
Human   308 PRVYWLGLNDRAQEGDWRWL-DGSPVTLSFWEPEEPNNI-----HDEDCATM----NKGGTWNDL 362

  Fly   362 PCSFETYFVCE 372
            .|...||::||
Human   363 SCYKTTYWICE 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tfcNP_612091.1 CLECT 249..373 CDD:153057 39/127 (31%)
CLEC17ANP_001191047.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..119
PHA03247 <6..153 CDD:223021
CLECT_DC-SIGN_like 254..374 CDD:153060 43/141 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.